Welcome to Striped

A free, fully responsive HTML5 site template by HTML5 UP

July 14, 2014

Georg Von Siemens - Wirtschaftswachstum Strukturwandel Und Dynamischer Wettbewerb - Die Produktion Zentraler Ffentlicher Rume In Der Aufmerksamkeitskonomie - Abwanderung Geburtenrckgang Und Regionale Entwicklung - Anlay- Und Regelwiderstnde - Fragrances - Fderalismus An Der Wegscheide - –kologische –konomie - Project Engineering - Betriebsorganisation Und Arbeitszufriedenheit - Building Global Security Through Cooperation - Leitfaden Umwelthandbcher Mit Praxisbeispielen - Hilfsbuch Dampfmaschinen-techniker - Diffuse Scattering Of X-rays And Neutrons By Fluctuations - Die Dynamik Der Selbststeuerung - Biochemie Und Physiologie Der Sekundren Pflanzenstoffe - Holografie - Spieltheorie - Lernstrungen Und Hirnfunktion - Xith International Astronautical Congress Stockholm 1960 - Man Sollte Nicht Den Finger Der Auf Den Mond Weist Den Mond Selbst Halten - Knotentheorie Einsteiger - Der Lange Weg Zur Erfolgsmannschaft - Die Analyse Der Milch Und Milcherzeugnisse - Progress In Hydrogeochemistry - Lehrbuch Der Mathematik - Wohlfahrtsstaat Im Wandel - Versicherungswirtschaftslehre - Jahrbuch Der Hafenbautechnischen Gesellschaft - Chemical Physics Of Redox Metalloenzyme Catalysis - Acta Historiae Neerlandicae Ix - Die Rztliche Visite - Vitalitt S Unternehmen - Die Kontrolle In Gewerblichen Unternehmungen - Disruptive Logic Architectures And Technologies - Jahresbericht Ber Die Beobachtungs-ergebnisse Der Von Den Forstlichen Versuchsanstalten - Diagnostik Und Therapie Der Lungen- Und Kehlkopftuberkulose - Sdafrika - Atlas Of Slices Of The Temporal Bone And Adjacent Region - Nfstellige Logarithmische Und Trigonometrische Tafeln - Wahl-kampf Um Europa - Praxisbuch Mrt Abdomen Und Becken - Wahrscheinlichkeitsrechnung Und Induktive Statistik - Single-photon-emissions-computertomographie Spect Des Gehirns - Computersicherheit - Enthalpie-entropie-diagramme Wasserdampf Und Wasser - Kundenrckgewinnungsmanagement Im Stationren Einzelhandel - Renal Transport And Diuretics Renaler Transport Und Diuretica - Die Subventionen Der Weltschiffahrt Und Ihre Sozialkonomischen Wirkungen - Heldenbilder Im Fernsehen - Gutachten Ber Die Elektrifizierung Der Strecke Wien Salzburg - Verdichteter Wohnungsbau - Aus Der Weiyen Stadt - Der Darmverschluss Und Die Sonstigen Wegstrungen Des Darmes - Klinische Rntgendiagnostik Chirurgischer Erkrankungen - Wissenschaftssoziologie - Processed Meats - Grundriy Der Wildbachverbauung - Management Von Diskontinuitten - Integrierte Hochfrequenzschaltkreise - Theorie Der Medizinischen Informatik - Der Mnnliche Habitus - Mehr Leidenschaft Recherche - Structure And Function In Normal And Abnormal Hips - Finanzausgleich Und Finanzbeziehungen Im Wiedervereinten Deutschland - Arbeitsbltter Friseure - Commodity Procurement With Operational And Financial Instruments - Das Methoden-repertoire Von Lehrern - Die Emailfabrikation Ein Lehr- Und Handbuch Die Emailindustrie - Lebensbedrohliche Ventrikulre Herzrhythmusstrungen - Nuklearmedizin In Der Orthopdie - Ultraschalldiagnostik 90 - Keine Panik Vor Ingenieurmathematik! - Psychische Krankheit Als Soziales Problem - Grundlagen Und Methoden Aufsuchender Jugendarbeit - Effektiv Starten Mit Turbo Pascal 60 - Elementare Logik - Anatomie Des Menschen - Chemie Und Struktur Der Pflanzen-zellmembran - External Environmental Costs Of Electric Power - Einhrung In Die Werkstoffe Der Elektrotechnik - Immunhistochemie Der Tumoren Des Nervensystems - Water And Life - Open Innovation In Life Sciences - Das Kontroll- Und Transparenzgesetz - Stochastische Prozesse - Sozialismus Und Nation - Handbuch Der Kinderheilkunde - Geist Und Macht Die Brentanos - Kreativitt Im Cyberspace - Recycling Von Elektro- Und Elektronikschrott - Soziologische Theorie Und Geschichte - Funktionentheorie Differentialtopologie Und Singularitten - Schwestern - Konflikte Und –ffentlichkeit - Feindbild Minderheit - Biofouling And Biocorrosion In Industrial Water Systems - 5 Kongrey Der Deutschsprachigen Gesellschaft Intraokularlinsen Implantation - Der Richter Wesen Und Verfassungsrechtliche Stellung - Die Dampfturbine Im Betriebe - Rechts- Und Linkspopulismus - Geometrie Und Symmetrie In Der Physik - Prfungsvorbereitung It-berufe - Rechtsgrundlagen Den Bankkaufmann - A Course In Mathematical Physics 3 - Innovative Kapitalanlagekonzepte - Bildung Und Beruf - Grundriss Des Kaufmnnischen Rechtes - Das Asbestzement-druckrohr - Jugend Und Wohnen - "ihre Werte Bitte!" - Finanz- Und Versicherungsmathematik - Demokratien In Europa - Integration Of Preference Analysis Methods Into Qfd For Elderly People - Theorie Der Stochastischen Automaten - Weltkultur Und Weltgesellschaft - –sterreich Zur Jahrhundertwende - Migration Und Nationaler Wohlfahrtsstaat - Der Modellbau Die Modell- Und Schablonenformerei - Carbid Und Acetylen - Grundlagen Der œbertragung Elektrischer Energie - Optionsbewertung Und Portfolio-optimierung - Aroma Biotechnology - Internationale Anlagengeschfte - Kommunikationsberatung Und Kommunikationstraining - Transurethral Surgery - Adaption Und Lernen Von Und In Organisationen - Marktwirtschaft In China - Ohne Gewhr - Klausurtraining Hydrochemische Berechnungen - Identitten In Der Modernen Welt - Arbeiten Im Virtuellen Zeitalter - Angewandte Elektrizittslehre - Berlin In Geschichte Und Gegenwart - Kohlenwirtschaftsorganisationen - Eclipse Phenomena In Astronomy - Fernsehfinanzierung - A Second Generation Pacs Concept - Forests Elements Of Silvology - Sozialer Wandel In Den Neuen Bundeslndern - Climate Earth Processes And Earth History - Betablocker Im Neuen Jahrtausend - Innovative Personalentwicklung - Intensive Elektronen- Und Ionenstrahlen - Holzbau - Early Pregnancy Loss - Praxis Der User Interface-entwicklung - Die Psychoanalyse Und Ihre Kinder - Handbuch Laser-strahlenschutz - Der Islamische Fundamentalismus Der Islam Und Die Demokratie - Der Eigenbedarf Mittlerer Und Groyer Kraftwerke - Die Vorbereitung Zu Chirurgischen Eingriffen - Die Vorbereitung Des Hochofenmllers - Die Kondensation Der Dampfmaschinen Und Dampfturbinen - Affective And Schizoaffective Disorders - Stahlbeton - Betriebliches –kocontrolling - Visual Basic Essentials - Operatorenrechnung - Photoreceptor Optics - Technik Im Wertekonflikt - Die Praxis Des Eisenhttenchemikers - Familienerziehung Im Historischen Wandel - Der Gmbh-geschftshrer - Leime Und Kontaktkleber - Politische Planung - Handbuch Der Seifenfabrikation - Treibstoffe Verbrennungsmotoren - Nizatidin - Elektro-fachrechnen 1 - Unternehmerhandbuch Bau - Die Restrukturierung Des Arbeitsmarktes - Aufgaben Politischer Bildung In Der Sekundarstufe I - Struktur Und Ereignis In Theorievergleichender Perspektive - Neues Jahrbuch Dritte Welt - Heterogene Katalyse I - Grundzge Der Botanik - Eigentlich Klar Oder - Die Krankhaften Psychischen Strungen Der Rckwandlungsjahre Vom Klinischen Standpunkt Aus - Distributed Autonomous Robotic Systems - Der Urknall - Die Neue Rechte Und Die Berliner Republik - Bausteine Syntaktischen Wissens - Fortschritte Der Elektrokardiologie 1963 Und 1964 - Stiftungsvermgen - Die Besten Manager 2009 - Herz- Und Kreislauferkrankungen Im Alter - Schlsseltechnologie-industrien - Kohlberg Und Seine Kritiker - Brger Und Demokratie In Ost Und West - Prozessregulation In Der Rhizosphre - Statistische Methode Die Zuverlssigkeitsanalyse - Bolivien Politisches System Und Reformprozess 19931997 - Das Reichsgesundheitsamt 18761926 - Kulturbetriebslehre - Berlin Metropole Zwischen Boom Und Krise - Schillerpromenade 27 12049 Berlin Ein Haus In Europa - Management Kreativer Prozesse - Strahlen Und Strahlenschutz - Ingenieur-mathematik Lehrbuch Der Hheren Mathematik Die Technischen Berufe - Jugend Religion Und Modernisierung - Beitrge Zur Jugendforschung - Aggregation And Representation Of Preferences - Chemische Sensoren - Nachhaltige Quartiersentwicklung - Stoffwechsel Und Energiewechsel - Planung Die Deutsche Einheit - Acute Pancreatitis - Die Funktional-orientierte Demokratie - Rickettsiosen Und Protozoenkrankheiten - Theories Of Fluids With Microstructure - Immunopharmacology - Das Neue Europarecht - Ludwig Boltzmann Principien Der Naturfilosofi - Tragwerksdynamik - Police Research In The Federal Republic Of Germany - Grundriss Der Mykologischen Diagnostik - Einhrung In Die Theoretische Physik - Abschied Von Der Toskana - Turbo Pascal 70 - Die Fortschrittsfalle - Grundkurs Biomathematik - Die Mikroskopische Untersuchung Der Seide Mit Besonderer Bercksichtigung Der Erzeugnisse Der Kunstseidenindustrie - Preparative Organic Photochemistry - Die Auslndische Familie - Die Wechseljahre Des Mannes - Jahrbuch - Politische Kommunikation Und Whlerverhalten - Berichterstattung Zur Sozio-konomischen Entwicklung In Deutschland - Teilhabe Im Umbruch - Kabeltechnik - Die Ferromagnetischen Legierungen Und Ihre Gewerbliche Verwendung - Demokratie Und Technik Keine Wahlverwandtschaft - Corrosion Of High-performance Ceramics - „lterwerden Im Betrieb - Einhrung In Den Wrme- Und Stoffaustausch - Politik Und Kontingenz - Beginning Android Adk With Arduino - Einhrung In Die Medienwissenschaft - Reef Diagenesis - Symmetrische Verschlsselungsverfahren - Coronary Stents - Systeme Und Subjektstrukturen - Brgerliches Recht - Moderne Und Gewalt - Das Heilbad Wiesbaden - Erfolgsorientierte Gesprchshrung - Parteienwettbewerb Im Bundesstaat - Berechnung Und Gestaltung Der Federn - Erbbiologie Und Erbpathologie Nervser Und Psychischer Zustnde Und Funktionen - Drosophila Melanogaster Meig - Werbe- Und Konsumerziehung International - Holding-strategien - Altern In Rumlicher Umwelt - Sprechwissenschaft And Psycholinguistik 2 - Entwurf Robuster Regelungen - Kanzler Und Minister 1949 1998 - Furniere Sperrholz Schichtholz - Lehrbuch Der Physiologischen Chemie - œberlebt Die Soziale Stadt - Numerik Partieller Differentialgleichungen Ingenieure - Grundzge Der Elektrotechnik - The Machine As Metaphor And Tool - Praxis Des Customer Relationship Management - Natural Products Chemistry Iii - Sprache Migration Und Schulfachliche Leistung - Mythos Determinismus - Viskoelastika Eine œbersicht - Biological Effects Of Polynucleotides - Die Bedingungen Ruhigen Laufs Von Drehgestellwagen Schnellzge - Pain And Kampo - Software Process Automation - Soziologische Aufklrung 3 - Quantenbiologie - Verschlsselungsalgorithmen - Die Grundlagen Der Raumkhlung - Werte Wettbewerb Und Wandel - Reliability Evaluation Of Engineering Systems - Mnnergewalt Gegen Frauen Beenden - Die Innovative Behrde - Der Schlaf - Gicht Und Rheumatismus - Ao-instrumente Und -implantate - Politikwissenschaftliche Spiegelungen - Pythagoras Der Quintenwolf Und Das Komma - Frieden Oder Sicherheit - Parasiten Des Menschen - Die Paranoia - Die Arbeitszeitermittlung Im Werkzeugbau - C++ Programmierer - Physik Und Umwelt - Wages Regime Switching And Cycles - Algebra Funktionalanalysis Und Codierung - Exotische Krankheiten - Pathologische Physiologie - Afrika Jahrbuch 1997 - Personalinformationssystem - Konvergenz Des Rechnungswesens - Das Verbrechen Ii - Wozu Experten - Asbestzement - Heilen Und Bilden - X-ray Astronomy - Postscript Level 2 Griffbereit - Orthogonalitt Und Approximation - Innovationen Im Mittelstand Erfolgreich Managen - Soziale Inklusion - Soziale Und Gesellschaftliche Differenzierung - Die Edelsthle - Fields And Particles - Kommunalpolitik - Geschftsprozesse Realisieren - Rollenspiel Als Forschungsmethode - Stochastik Einsteiger - Die Hirnttigkeit Des Suglings - Hhere Mathematik Ingenieure - Der Souvern Auf Der Nebenbhne - Ein Nachhaltig Anderes Parteiensystem - Die Verunreinigung Der Gewsser Deren Schdliche Folgen Sowie Die Reinigung Von Trink- Und Schmutzwasser - „meine Frau Managt Das Ganze Leben Zu Hause - Lexikon Der Psychiatrie - Die Eisenbahn - Transportsteuer Und Ihre Stellung Im Staatshaushalte - Pro Oracle Spatial For Oracle Database 11g - Fdp Partei Der Zweiten Wahl - Strmungslehre In Fragen Und Aufgaben - Politische Kommunikation Im Internationalen Vergleich - Wahrscheinlichkeitsrechnung Und Stochastische Prozesse - Urbane Bden - Der Beruf Des Chirurgen - Vertragsfreiheit Und Typengesetzlichkeit Im Recht Der Personengesellschaften - Atlas Der Lokalansthesie - Banken Und –kologie - Advances In Manufacturing Technology Ii - Zentralabitur - Afrika Jahrbuch 1988 - Die Dreidimensionale Ultraschalldiagnostik - Revision Des Grundgesetzes - Informations- Und Kodierungstheorie - Handbuch Frhkindliche Bildungsforschung - Distributive Justice And Inequality - Erfahrung Und System - Digital Memory And Storage - Entwicklung Der Offenen Jugendarbeit In Wolfsburg - Numerische Methoden Im Cad - Dermatologie - Working Through Ethics In Education And Leadership - Cytopathology - Bauphysikalische Temperaturberechnungen In Fortran - Die Besten Den Vertrieb - Das Trockengleichrichter-vielfachmeygert - Cable Shielding For Electromagnetic Compatibility - Unbestimmte Transzendenz - Ganzheitliches Direktmarketing - Principles Of Infrared Technology - The Silent Countdown - Wahrscheinlichkeitstheorie - Ehen Und Ihre Freundschaften - Der Plan Als Befehl Und Fiktion - Ultraprecision In Manufacturing Engineering - Lndliche Armut Im Umbruch - Die Relaissteuerungen Der Modernen Starkstromtechnik - Lebensmittelmikrobiologie - Wie Ich Pluto Zur Strecke Brachte - Aachener Bausachverstndigentage 2009 - Zwischen Rausch Und Realitt - Stckkostenrechnung - Intellektuelle Und Sozialdemokratie - Kreisfrmig Gekrmmte Trger Mit Starrer Torsionseinspannung An Den Auflagerpunkten - Investment - Teubner-taschenbuch Der Stochastik - Sammlung Der Internationalen Vereinbarungen Der Lnder Der Bundesrepublik Deutschland - Peripheral Blood Stem Cell Autografts - Innere Sekretion Und Chirurgie - Shock Waves @ Marseille Ii - Pfadfinden - Evolving Strategies And Tactics In Membrane Research - Schler Und Politik - Early Papers On Diffraction Of X-rays By Crystals - Die Versorgung Des Brandverletzten Im Katastrophenfall - Koordination Von Supply Chains Durch Mengenbindungsvereinbarungen - Grundriss Einer Meteorobiologie Des Menschen - Hochbau Konstruktion - Experimentelle Forschungen Ber Bleiaufnahme Und Bleiausscheidung Und Ihre Bedeutung Gewerbehygiene Und –ffentliche Gesundheit Unter Besonderer Bercksichtigung Von Bleitetrathyl Und Bleihaltigen Kraftstoffen - Authentische Aufgaben Im Theoretischen Bereich Von Instruktions- Und Lehr-lern-forschung - Intermolecular Forces - Eliten In Europa - Aufgaben Aus Der Maschinenkunde Und Elektrotechnik - Hochschulreform In Europa Konkret - Von Cim Zur Unternehmensintegration - Literatur Und Journalismus - Lehrbuch Der Thermochemie Und Thermodynamik - Urologische Beckenchirurgie - Medienalltag - Unabhngige –ffentlichkeit Und Soziale Bewegungen - Die Apotheken-gesetzgebung Des Deutschen Reiches Und Der Einzelstaaten Auf Der Grundlage Der Allgemeinen Politischen Handels- Und Gewerbegesetzgebung Dargestellt - Rechnungswesen Brokaufleute - Betriebliche Altersversorgung - Die Arzneikombinationen - Soziologische Theorie Der Gegenwartsgesellschaft - Evolutionary Biology - Marke D - Technik Arbeit Betrieb Gesellschaft - Der Januskopf Der Prominenz - Mediation - Die Preuyischen Apothekengesetze - Wahl Der Nahrungsproteinegrundlagen Und Ditetik - Die Gesammte Lehre Der Waldstreu Mit Rcksicht Auf Die Chemische Statik Des Waldbaues Unter Zugrundlegung Der In Den Knigl Staatsforsten Bayerns Angestellten Untersuchungen - Optische Sensorik - Waldhumusdiagnose Auf Biomorphologischer Grundlage - Familie Und Staatliches Handeln - Qualitative Bildungs- Und Arbeitsmarktforschung - Ganzheitliche Bilanzierung - Spaltungen Der Gesellschaft Und Die Zukunft Des Sozialstaates - Ideologien In Der Weltpolitik - Biologische Restabfallbehandlung - Lernort Kinderfreunde - Die Untersuchung Und Beurteilung Des Wassers Und Des Abwassers - Der Hochbau - Encyclopedia Of Textile Finishing - Virus- Und Rickettsieninfektionen Des Menschen - Derivative Finanzinstrumente - Das Dividendenbezugsrecht Des Aktionrs - Atomic Physics Of Highly Charged Ions - Unixâ„¢ Das Betriebssystem Und Die Shells - Eisenguy In Dauerformen - Einhrung In Die Betriebswirtschaftliche Organisationslehre - Griechische Sakralaltertmer Hhere Lehranstalten Und Den Selbstunterricht - Vwl Berufsschulen - Transnationale Vergesellschaftungen - Matlab Und Simulink In Der Ingenieurpraxis - Handbook Of Research On Student Engagement - Cardiovascular Biomaterials - Milde Hypertonie Und Leichte Fettstoffwechselstrungen - Funktionssysteme Der Gesellschaft - Die Zweite Groye Koalition - Kurze Chirurgische Operationslehre - Berhrungen Und Schule - Deutungsmuster Von Lehrkrften - Schlussbericht Der Enquete-kommission Recht Und Ethik Der Modernen Medizin - Reibung Und Schmierung Fester Krper - Kompaktkurs Mikrocontroller - Multiprozessorsysteme - Die Praxis Der Hydrotherapie Und Verwandter Heilmethoden - E-mail-marketing - Grenzobjekte - Abschottungs- Und Anwerbungsstrategien - Frhwarnindikatoren Und Krisenfrhaufklrung - Der Kreislaufkollaps - Sozialgeschichte Der Psychologie - Grenzen Des Sozialraums - Soziale Netzwerke In Unternehmen - Vom Obrigkeitsstaat Zur Entgrenzten Politik - Regionalisierung - Trkische Unternehmensgrndungen Von Der Nische Zum Markt - Innovation Technik Zukunft - Der Kopfschmerz - Controlling Von Projekten - Handbuch Der Eierkunde - Die Neueren Farbstoffe Der Pigmentfarben-industrie - Software-metriken In Der Praxis - Soziale Unruhen Und Politikberatung - Jugend In Ostdeutschland Lebenssituationen Und Delinquenz - Reformen In Wohlfahrtsstaaten - Armut Gerechtigkeit Und Soziale Grundsicherung - Die Neue Rechte In Deutschland - Die Betriebsbuchhaltung Der Chemischen Industrie - Generation Transformation - Mob Oder Souvern - Urbanismus Und Verkehr - Der Frser Als Rechner - Konsum - Der Kationen- Und Wasserhaushalt Des Mineralbodens - Die Wassermannsche Reaktion In Ihrer Serologischen Technik Und Klinischen Bedeutung Auf Grund Von Untersuchungen Und Erfahrungen In Der Chirurgie - Richard Dedekind 18311981 - Drogisten-lexikon Ein Lehr- Und Nachschlagebuch Drogisten Und Verwandte Berufe Chemotechniker Laboranten Groyhandel Und Industrie - Anticarcinogenesis And Radiation Protection - Einhrung In Die Mechanik Mit Einfachen Beispielen Aus Der Flugtechnik - Die Kalkulation Und Organisation In Frbereien Und Verwandten Betrieben - Testmanagement Bei Sap-projekten - Alle Macht Den Banken - Fernsehen Als Objekt Und Moment Des Sozialen Wandels - Biographieforschung Und Kulturanalyse - Friedensstrategien - Soziale Arbeit Als Transdiziplinre Wissenschaft - Turbo Pascal-wegweiser Aufbaukurs - Familie Als Beruf Arbeitsfeld Der Zukunft - Demokratien Des 21 Jahrhunderts Im Vergleich - Transportvorgnge In Der Verfahrenstechnik - Reformierung Des Gesundheitssystems Oder In Welchem Gesundheitssystem Wollen Wir Leben - Der Waldwegbau Und Seine Vorarbeiten - Energiewirtschaft - Leveraged Buyouts - Hmangiome - Hren Im Ffentlichen Bereich Und In Non-profit-organisationen - Hrungsinstrument Kommunikation - Die Physiologische Entwicklung Des Kindes - Das Wrmetechnische Meywesen In Dampfkraftwerken Und Industriebetrieben - A Brief History Of Computing - Diurese Und Diuretica Diuresis And Diuretics - Umwelt Global - Welding Metallurgy Of Stainless Steels - The Chemical Physics Of Surfaces - Die Dampfturbinen Mit Einem Anhange Ber Die Aussichten Der Wrmekraftmaschinen Und Ber Die Gasturbine - Stahlbau - Das Fenster Zum Raum - Atlas Of Endoscopic Perforator Vein Surgery - 100 Minuten Konfigurationsmanagement - Calcified Tissues 1965 - Kriminalitt Und Sicherheitspolitik - Das Erklrte Universum - Psychologie Als Empirische Wissenschaft - Handchirurgischer Ratgeber - Applied Ontology Engineering In Cloud Services Networks And Management Systems - Transatlantik - Numerik Symmetrischer Matrizen - Ergebnisse Der Lepraforschung Seit 1930 - Startup - Die Blei-zinkerzlagersttte Von Bleiberg-kreuth In Krnten - Immuntherapie In Der Uroonkologie - Grundzge Zu Einer Wissenschaftlichen Theorie Des Freihandels - Computer In Der Schule 3 - Rock Mechanics - Einfach Mehr Umsatz - Die Ermittlung Der Kegelrad-abmessungen - Praxiswissen Radar Und Radarsignalverarbeitung - Steinkohlenteer - Abschied Von Der Top-down-kultur - Interkulturelle Handlungskompetenz - Cocas Fluch - Die Ohnmacht Bei Der Geburt Vom Gerichtsrztlichen Standpunkt - Die Przisionsbestimmung Von Gitterkonstanten Nach Der Asymmetrischen Methode - Die Regiebetriebe Der Gemeinden - Junge Familien In Der Bundesrepublik - Umbrche In Der Industriegesellschaft - Dynamischer Wettbewerb - The Scars Of Venus - Mobilitt Lterer Menschen - Alfred Andersch - Windkraftanlagen Im Netzbetrieb - Die Fabrikation Der Bleichmaterialien - Prozess- Und Projektmanagement Itil - Medienregulierung Durch Die Gesellschaft - Individualisierung Und Integration - Regionale Analyse Mit Kleinen Gebietseinheiten - Starthilfe Physik - Nationale Selbst- Und Fremdbilder Im Gesprch - Computed Tomography Anatomy And Morphometry Of The Lower Extremity - Das Berufsbildungssytem In Deutschland - Bibliographie Zur Deutschen Soziologie - Entkriminalisierung - Devianz - Familienunternehmen Auslaufmodell Oder Erfolgstyp - Distributed Information Systems In Business - Von Der Deutschlandpolitik Zur Ddr-politik - Die Berechnung Des Waldkapitals Und Ihr Einfluy Auf Die Forstwirtschaft In Theorie Und Praxis - –kologische Stadtentwicklung - Grne Gentechnik - Gestaltungschance Und Entwicklungsrisiko - Die Grundgesetze Der Wrmeleitung Und Ihre Anwendung Auf Plattenfrmige Krper - Handbuch Der Appretur - Drahtlose Telegraphie Und Telephonie - Programmierung Wirtschaftsinformatiker - Die Chirurgischen Indikationen In Der Nervenheilkunde - Marketingstrategien Rezeptfreie Arzneimittel - Innovationspolitik In Globalisierten Arenen - Einhrung In Die Klassische Elektrodynamik - Stadt Und Soziale Ungleichheit - Interaktionsordnungen - Cervical Spine I - Student Participation In Online Discussions - Karsthydrogeologie - Fertigungsverfahren Der Mechatronik Feinwerk- Und Przisionsgertetechnik - Neuronale Netze In Der Finanzwirtschaft - Der Wrmebergang Und Die Thermodynamische Berechnung Der Leistung Bei Verpuffungsmaschinen Insbesondere Bei Kraftfahrzeug-motoren - Spektrale Zuordnungstafel Der Infrarot-absorptionsbanden - Treatise On Heavy Ion Science - Demografischer Wandel In Der Unternehmerischen Praxis - Die Lehre Neu Verstehen Die Wissenschaft Neu Denken - Lehrbuch Der Bder- Und Klimaheilkunde - Handbuch Bankcontrolling - Visuelle Kommunikationsforschung - Teubner-taschenbuch Der Statistischen Physik - Regional Advantage And Innovation - Einhrung In Die Gegekunde Der Geologischen Krper - Grundlagen Der Elektrischen Energieversorgung - Medien-mythos - New Aspects Of Hypertrophic Cardiomyopathy - Technikfolgenabschtzung - Einhrung In Die Technische Behandlung Gasfrmiger Stoffe - Lsungsheft Grundbildung Kaufleute - Flexible Plankostenrechnung Und Deckungsbeitragsrechnung - Grundzge Der Technischen Schwingungslehre - Wachsende Stadt - Zur Interkommunalen Handhabung Des Zinsrisikos - Wrterbuch Zur Mikropolitik - Informationssysteme Hochschulen - Proceedings Of The Third Conference On Mechatronics And Robotics - Die Geologischen Grundlagen Der Verbauung Der Geschiebeherde In Gewssern - Frickknll Baukonstruktionslehre 2 - Migrne - The Subcommissural Organ - Die Transintentionalitt Des Sozialen - Die Wertheim-studie - Die Lehre Vom Raumsinn Des Auges - Medical Parasitology - Stdtebau - Stahlbetonbau Nach Din 1045-1 - Mathematical Physics X - Hauptwerke Der Ungleichheitsforschung - Kreativitt Und Krankheit - Constitutive Modelling In Geomechanics - Defekte Demokratie - Diagnostik Der Chirurgischen Nierenerkrankungen - Kleiner Ratgeber Den Apothekenkauf - Vertrauen Kooperation Netzwerkbildung - Endothelial Mechanisms Of Vasomotor Control - Menschen Machen Wirtschaft - Beispiele Aus Der Baubetriebspraxis - Theoretische Grundlagen Der Elektrotechnik 1 - Regiomontanus - Steuerfall Und Lsung - Europische Integration Im Kontext Des Rechts - Ernst Mach - Neuroactivation And Neuroimaging With Spet - Verkehrsleittechnik Den Strayenverkehr - Pdagogische Permissivitt - Genussrechte - Lust Auf Zukunft - Paradigmen Der Bewegungsforschung - Identittsfalle Oder Weltbrgertum - Der Wandel Des Franzsischen Parteiensystems - Interkulturelle Pdagogik Und Sprachliche Bildung - Die Geburt Der Schnen Bilder - Schule In Der Wissensgesellschaft - At1-rezeptorantagonisten - Psychoanalyse Heute - Das Mensch-tier-verhltnis - Kernphysik - Handbuch Der Radium-biologie Und Therapie - Theorie Als Kampf - Femorokrurale Arterienverschlsse - Kurze Geschichte Der Chirurgie - Ehre Oder Amt - Elektromagnete - Zuverlssigkeits- Und Instandhaltungstheorie - Impulsschaltungen - Migration Und Schulischer Wandel Leistungsbeurteilung - Electronic Fashion - Aussagefhigkeit Und Aussagewilligkeit Von Probanden Bei Der Conjoint-analyse - Baroreceptor Reflexes - Theorie Der Institution - Medicinisch-klinische Diagnostik - Raumbildung Bildungsrume - Die Wissenschaftlichen Grundlagen Der Elektrotechnik - Mythos Familie - Convection In Liquids - Professionalitt Und Alltag In Der Erziehungsberatung - Das Rztliche Gutachten Im Versicherungswesen - Bioanalytik - Menschheit Auf Dem Prfstand - Bioastronomie - Lineare Algebra Und Analytische Geometrie I - Praxis Der Psychodramatischen Supervision - Jugend Und Arbeitswelt - Meywert-analyse - Jenseits Von Identitt Oder Integration - Tunnelbaugeologie - Lebensqualitt-atlas - Bauobjektberwachung - Praktischer Korrosionsschutz - Immigranten Im Wohlfahrtsstaat - Vetospieler In Der Policy-forschung - Nf Jahrtausende Radfahrzeuge - Staat Und Technische Kommunikation - Einhrung In Die Betriebswirtschaftslehre - Klinische Konstitutionslehre - Die Vermessung Kultureller Unterschiede - Dynamic Stiffness And Substructures - Progress In Industrial Mathematics At Ecmi 94 - Politik Und Verwaltung Nach Der Jahrtausendwende Pldoyer Eine Rationale Politik - Schlkes Tafeln - Quantum Fields Algebras Processes - Social Skills - Afrika Jahrbuch 1990 - Migration Sprache Und Kulturelles Kapital - Diamantbohrungen Schrf- Und Aufschluyarbeiten Ber Und Unter Tage - Automation In The Food Industry - Sprachprozesse Und Wissensstrukturen - Thermodynamische Eigenschaften Umweltvertrglicher Kltemittel Thermodynamic Properties Of Environmentally Acceptable Refrigerants - Einhrung In Das Einheitliche Wechselrecht - Organtransplantation In Rats And Mice - Einhrung In Die Praktische Pharmazie Apothekerpraktikanten - Geographic Information Systems Spatial Modelling And Policy Evaluation - Von Welchen Supply-chain-management-maynahmen Profitieren Automobilzulieferer - Vernetzte Organisationen - Synchronization Of Eeg Activity In Epilepsies - Bildungskontexte - Anleitung Zum Frischhalten Der Lebensmittel - Magnetic Resonance - Zwei Kulturen - Journalisten Im Netz - Classical Dynamics And Its Quantum Analogues - Image Transfer Through A Scattering Medium - Umweltschutz Durch Internationale Regime - Teilhaben An Schule - Dekonstruktion Von Geschlechtsidentitt Transversale Differenzen - Grundzge Der Unternehmensbesteuerung - Enterprise Wikis - Hereditary Colorectal Cancer - Bericht Ber Die Einundnfzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft - Vertrauen Und Glaubwrdigkeit - Business-impact-management Von Informationstechnologie Im Unternehmen - Bifurcations - Die Harnrhren-gonorrhoe Des Mannes Und Ihre Komplikationen - Digitaltechnik - Institutionalisierung Psychosozialer Versorgung - Moderne Probleme Der Metallphysik - Elemente Der Elektronik - Repetitorium Und Prfungstrainer - Elektrochirurgie Am Auge - Photonen - Die Hebezeuge Theorie Und Kritik Ausgehrter Konstruktionen Mit Besonderer Bercksichtigung Der Elektrischen Anlagen Ein Handbuch Ingenieure Techniker Und Studirende - Wahlkampf In Den Medien Wahlkampf Mit Den Medien - Literatursoziologie - Assessment Center - Progress In Advanced Structural And Functional Materials Design - Primate Vocal Communication - Biochemistry And Physiology Of Visual Pigments - Jugendkonsum Im 21 Jahrhundert - Die Verwaltung Der Eisenbahnen - Integriertes Content Management In Fernsehunternehmen - Stadtbaugeschichte Von Der Antike Bis Zur Neuzeit - Demokratie In Europa Und Europische Demokratien - Faszination - Landwirtinnen - Walther Gerlach 18891979 - Managen Mit Methode - Frauen- Und Mdchenprojekte - Analysis With Supercritical Fluids Extraction And Chromatography - Die Radium- Und Mesothoriumtherapie Der Hautkrankheiten - Physics Of Solar Variations - Lehrbuch Der Kinderheilkunde - Leitfaden Gerbereichemische Untersuchungen - Moderner Wahlkampf - Aufwachsen Und Lernen In Der Sozialen Stadt - A Primer Of Neuroimmunological Disease - Psychodrama - Risk Behaviour In Adolescence - Information Processing In The Nervous System - Tragwerkselemente - Qualittsmanagement In Non-profit-organisationen - Klassiker Der Pdagogik - Die Therapie Der Syphilis - Erfolgsfaktor Vertrauen - Soziologische Aufklrung 6 - Untersuchung Und Bestimmung Der Lipoide Im Blut - Handbuch Sexualstraftaten - Gewerkschaften In Der Japanischen Politik Von 1970 Bis 1990 - Staatsbrgerschaft Im Einwanderungsland Deutschland - Gelbsucht - Der Neue Sozialstaat - Pro Spring Mvc With Web Flow - Biomicroscopy Of The Peripheral Fundus - Imaging Techniques Of The Cns Of The Neonates - Der Geist Der Technik - Ultrasonography Of The Spleen - Klinische Infektionslehre - Die Cross-methode Und Ihre Praktische Anwendung - Mnemotechnik Der Receptologie - Grundlagen Der Prozesstheorie - Traumatic Hip Dislocation In Childhood - Physik-œbungen Ingenieure - Abschied Von Der Normalfamilie - Nachhaltige Entwicklung In Industrie- Und Bergbauregionen Eine Chance Den Sdraum Leipzig - Gebrochene Identitten - Mittelstand Hat Zukunft - Kommunikationsmanagement - 100 Rezepte Turbo Pascal - Regional Acidification Models - Die Grundstrukturen Einer Physikalischen Theorie - Die Organischen Katalysatoren Und Ihre Beziehungen Zu Den Fermenten - Die Malaria - Zuwanderung Und Integration - Sucht Und Armut - Sich Zeigen Und Die Welt Zeigen - Intraoperative Ultrasound Imaging In Neurosurgery - Principles Of Petroleum Reservoir Engineering - Physik Und Technik Der Atomreaktoren - Massen-tafeln Zur Bestimmung Des Gehaltes Stehender Bume An Kubikmetern Fester Holzmasse - Soziale Kontrolle Und Individualisierung - Krankenernhrung - Interessen Und Institutionen In Der Internationalen Politik - Lernen In Der Informationsgesellschaft - Architektur Des Mittelalters - Wind Turbines - Traditionales Denken Und Modernisierung - Stabtragwerke Matrizenmethoden Der Statik Und Dynamik - Die "economie Des Conventions" - Praxis_ci - Expertiseforschung - Kontext Und Kontingenz - Das Einrichten Von Automaten - Physicochemical Aspects Of Polymer Surfaces - Nach Dem Crash Ist Vor Dem Crash - Experimentelle Psychologie In Demonstrationen - Feuerungsuntersuchungen Des Vereins Feuerungsbetrieb Und Rauchbekmpfung In Hamburg - Der Gestaltete Lernkontext - Gesellschaft Innovativ - Entstehung Und Rckgang Des Landwirtschaftlichen Groybetriebes In England - Biometrie - Neue Soziale Bewegungen - Vita-massenez Chemische Untersuchungsmethoden Eisenhtten Und Nebenbetriebe - Der Landwirtschaftliche Kredit Und Seine Durchgreifende Verbesserung - Allgemeine Sinnesphysiologie - Systematische Klassifikation Der Massengesteine - Anonymitt Im Internet - Radiology Of Thalassemia - Leitfaden Zur Pflege Der Wchnerinnen Und Neugeborenen - Rehabilitation Als Biographischer Prozey - Fachinformation Online - Aspekte Der Internationalen –konomieaspects Of International Economics - Recent Developments In Carbonate Sedimentology In Central Europe - Die Stille Macht - Programmieren In Prolog - Analytische Berechnung Elektrischer Leitungen - Die Meistbegnstigung Im Modernen Vlkerrecht - Raus Aus Der Demotivationsfalle - Acoustics Of Solids - Betrieb Von Elektrizittswerken - Das Schielen - Entwicklungspsychologie Des Jugendalters - Privatheit Garten Und Politische Kultur - Der Anomische Staat - The Contextual Challenges Of Occupational Sex Segregation - Facets Of Modern Biogeochemistry - Der Praktische Maschinenzeichner - Evaluation Von Programmen Und Projekten Eine Demokratische Kultur - Die Flexible Supervision - Pancreatitis - Innovative Regulierung - Soft Skills Freelancer - Der Liquor - Autologous Resurfacing And Fracture Dowelling - Pro Android 4 - Die Filterung Der Atemluft Und Deren Bedeutung Staubkrankheiten - Praktikum Der Pflanzenanatomie - Physical Approaches To Biological Evolution - Das Skizzieren Von Maschinenteilen In Perspektive - Grundlagen Der Steuerungstechnik - Nachhaltiges Personalmanagement - Gabler Kompakt Lexikon Umwelt- Undwirtschaftspolitik - Neue Werkstoffe - Junge Erwachsene In Europa - Hepatocellular Carcinoma And Liver Metastases Diagnosis And Treatment - Erfolgreiches Markenmanagement - Die Schwimmbagger - The Changing Faces Of Ireland - Atomkraft - Novell Netware - Production Planning In Automated Manufacturing - Der Risikodiskurs - Klteprozesse - Akteure Beim Bodenschutz - Illustrated C 2012 - Puk - Tron Project 1988 - Regieren In Koalitionen - Nitrates And Nitrate Tolerance In Angina Pectoris - Einhrung In Die Theoretische Gasdynamik - Lokales Sozialkapital Die „soziale Stadt - Die Kinematographische Kamera - Glasfaserverstrkte Kunststoffe - Die Entwicklung Ihres Unternehmens - Stadt Im Umbruch Gotha - Erziehungs- Und Bildungspartnerschaften - Chirurgische Operationslehre - Die Asynchronmotoren Und Ihre Berechnung - Die Medikamentse Und Allgemeine Behandlung Der Ohrenkrankheiten - Die Wirtschaftliche Erzeugung Der Elektrischen Spitzenkraft In Groystdten - A Handbook For Clinical Teachers - Werbung Medien Und Kultur - Strahlenklima Der Erde - Die Waldstreu Und Ihre Bedeutung Boden Und Wald - Humangenetische Beratung - Qualittsmanagement Und Zertifizierung - Smiths Urologie - Das Wort Hat Der Herr Bundeskanzler - Physik Formelsammlung - Die Dampfkessel - Der Tod In Dichtung Philosophie Und Kunst - Advanced Methods Of Physiological System Modeling - Baukonstruktion Im Planungsprozess - Bankmarketing Im Firmenkundengeschft - Boundary Element Methods In Engineering - Theorie Praktischer Probleme - Hmatologie Und Onkologie - Kooperation Im Niemandsland - Die Raumbeziehungen Im Wirtschaften Der Welt - Ontogeny Cell Differentiation And Structure Of Vascular Plants - Rstungskooperation Und Technologiepolitik Als Problem Der Westeuropischen Integration - Handbuch Jugend - Musik - Sozialisation - Electron Microscopy Of Plant Pathogens - Der Demokratische Verfassungsstaat - User Experience Innovation - „nicht So Wie Unsere Eltern! - Rhizodeposition Und Stoffverwertung - Management Der Wertschpfungsketten In Banken - Data Mining Im Personalmanagement - Interaktive Medien Interdisziplinr Vernetzt - Die Flssigen Brennstoffe - Die Wassersperrarbeiten Bei Bohrungen Auf Erdl - Stability Theory - Die Anfangsstadien Der Wichtigsten Geisteskrankheiten - Partielle Differentialgleichungen - Effekte Eines Gerontopsychiatrischen Zentrums Auf Das Regionale Versorgungssystem Psychisch Gestrter Lterer Menschen - Briefe Von Und An Lassalle Bis 1848 - Die Kltemaschine - Praxis Der Mikrophotographie - Fachbezogene Informationsverarbeitung - Der Elektrische Lichtbogen Bei Gleichstrom Und Wechselstrom Und Seine Anwendungen - Die Volkswirtschaftliche Bilanz Und Eine Neue Theorie Der Wechselkurse - Sexualmoral Und Zeitgeist Im 19 Und 20 Jahrhundert - Lexikon Der Pflanzlichen Fette Und –le - Das Wachstum Von Verwaltungsorganisationen - Die Hrungsaufgabe - Synthetic Aspects Of Aminodeoxy Sugars Of Antibiotics - Identitt Und Interesse - Die Japanischen Manager - Lehrbuch Der Demagogik - Konfliktforschung - Operationslehre Der Endoskopischen Chirurgie 1 - Photonic Packaging Sourcebook - Zeichenlehre - Mathematische Grundlagen Der Elektrotechnik - Spices Condiments And Seasonings - Alzheimer Disease - Lehrbuch Der Zahnrztlichen Kronen-und Brckenprothetik - Lipide Und Lipoproteide Im Blutplasma - Internetstrategien Von Lokal- Und Regionalzeitungen - Kognitive Verhaltenstherapie Depressiven Grbelns - Wertkarten Zahlungsverkehr - Personenbezogene Soziale Dienstleistungen - Neue Steuerungsmodelle Frischer Wind Im Jugendhilfeausschuss - Excel 40 - Praxis Des Cash Managements - Einhrung In Die Physikalische Chemie Biochemiker Mediziner Pharmazeuten Und Naturwissenschaftler - Ostdeutsche Jugendliche - Benzin Benzinersatzstoffe Und Mineralschmiermittel Ihre Untersuchung Beurteilung Und Verwendung - Soziometrie - Die Wirkung Niedriger Strahlendosen - Allokationseffizienz In Der Rechtsordnung - Verstndliche Wissenschaft - Rauschen - Dormagener Qualittskatalog Der Jugendhilfe - Sensitivity Analysis In Linear Systems - Geschichte Der Nachrichtentechnik - Die Westeuropischen Gesellschaften Im Vergleich - Handbuch Zur Gleichstellungspolitik An Hochschulen - Betriebswirtschaftslehre Und Betriebliche Praxis - Kernprobleme In Der Geschichte Der Psychologie - Migration In Und Nach Europa - Energie- Und Klimaeffiziente Produktion - Heidelberger Gelehrtenlexikon - Das Private Und Die Technik - Messung Der Oberflchengte - Die Chromatische Alteration Im Liturgischen Gesang Der Abendlndischen Kirche - Marken In Der Politik - Meniskussonographie - Hallgeneratoren - Erworbene Schriftsprachstrungen - Implant Bone Interface - Рост Кристаллоь Rost Kristallov Growth Of Crystals - Calcium In Muscle Contraction - Die Gegenwrtigen Behandlungswege Der Kieferschussverletzungen - Die Behandlung Der Verrenkungen - Teilchenphysik Aus Heutiger Sicht - Informationstechnologie Ingenieure - Die Wissensordnung - Die Lehren Der Forstwissenschaft - Brennstoffe · Kraftstoffe Schmierstoffe - Bevlkerungssoziologie - Klima Und Gradtage In Ihren Beziehungen Zur Heiz- Und Lftungstechnik - Meningitis Im Kindesalter Und Neugeborenensepsis - Der Rationelle Getreidebau - Spannungsfeld Personalentwicklung - Qualitt Statt Quantitt - Lehrbuch Der Ernhrungstherapie Innere Krankheiten - Die Tumoren Der Pinealisregion - Von Der Abfallwirtschaft Zur Kologischen Stoffwirtschaft - Ausschreibungshilfe Auyenanlagen Und Tiefbau - Digital Products - Finanzmrkte Nach Dem Flchenbrand - Europische Unternehmensbesteuerung - Die Prfung Der Chemischen Reagentien Auf Reinheit - Staat Und Globalisierung - œbergang Zur Erwerbsttigkeit - Mineralogisches Taschenbuch Der Wiener Mineralogischen Gesellschaft - Adapting Historical Knowledge Production To The Classroom - Kostenberechnung Im Ingenieurbau - Einhrung In Die Meytechnik - Technisches Zeichnen - Digitales Fernsehen In Deutschland - Heimat In Zeiten Erhhter Flexibilittsanforderungen - Digitale Lernwelten - Wir Sind Die Marsmenschen - Textproduktion Im Dialog - Magnetospheric Physics - Anticipative Criminal Investigation - Brgermeister Curtius - Die Flotation In Theorie Und Praxis - Physics Of Thin Films - Forststhetik - Analytical Techniques Of Celestial Mechanics - Arbeitsorganisation Und Neue Technologien - Der Kalium-natrium-austausch Als Energieprinzip In Muskel Und Nerv - Cervical Spine Ii - Die Electrische Beleuchtung - Bone Densitometry And Osteoporosis - Die Wiederentdeckung Der Vereinten Nationen - Berechnung Der Maschinenelemente - Bildung Neu Denken! Das Juristische Konzept - Jugendkriminalitt - The Psychology Of Expertise - Dark Matter In The Universe - Umweltschutz Produktqualitt Und Unternehmenserfolg - Esd The Scourge Of Electronics - Methodologie Methoden Forschungsdesign - Leitfaden Der Bewegungsbestrahlung - Endoscopic Retrograde Pancreaticocholangiography Erpc - Die Knochengeschwlste - Fast Numerical Methods For Mixed-integer Nonlinear Model-predictive Control - Profitabel Wachsen - Steuerrecht In Nonprofit-organisationen - Social Entrepreneurship And Social Business - Elektronenmikroskopische Untersuchungs- Und Prparationsmethoden - Fit Den Generationswechsel Im Unternehmen - Ko-evolution Von Gesellschaft Und Funktionalem Staat - Die Fabrikation Der Feuerfesten Steine - Computergesttzte Netzplantechnik - Analysis Technische Oberschulen - Vertriebscontrolling Optimieren - Windkraftanlagen - Computed Tomography - Medikamentse Krebsbehandlung - Solvency Ii And Risikomanagement - A Short Textbook Of Clinical Imaging - Die Dampflokomotive - Grundlagen Der Elektronik - Autocad-aufbaukurs - Chernobyl - Plastics Processing Data Handbook - Molecular Cytogenetics - An Atlas Of Rectal Endosonography - „franz Oppenheimer - Olfaction And Taste Xi - –kologisches Arbeiten - Geschichte Der Herzrhythmusstrungen - Terrigenous Mass Movements - Neurasthenie - Der Bundestagswahlkampf 1998 - Programmierhandbuch Den Ibm Pc - Ultrasound Of Appendicitis - Sandstone Depositional Models For Exploration For Fossil Fuels - Concise Cardiology - Magnetic Resonance Imaging And Spectroscopy In Sports Medicine - Lehrbuch Der Zeitgemyen Vorkalkulation Im Maschinenbau - Hydrostatische Mess-instrumente - Die Wirkungen Von Gift- Und Arzneistoffen - Radioforschung - Medienkriege - Die Goliath-falle - Service-exzellenz - Arthroscopy Of The Knee Joint - Chaos Und Systeme - Knig Brgermeister Bundeskanzler - Merkmale Und Reprsentationen - Differentialoperatoren Der Mathematischen Physik - Atlas On The Biology Of Soil Arthropods - Das Prdikat Im Deutschen - Rekonstruktion Narrativer Identitt - Elektrische Ausgleichsvorgnge Und Operatorenrechnung - Konfliktkompetenz - Die Parkinsonsche Krankheit Und Ihre Behandlung - Einhrung In Die Vererbungswissenschaft - Phnomenologie Des Wollens - An Outline Of Neurosurgery - Digital Value Network - Kompetenzmanagement In Der Praxis - Innovation Resources And Economic Growth - Die Berechnung Elektrischer Anlagen Auf Wirtschaftlichen Grundlagen - Gold And Other Precious Metals - Der Unscharfe Ort Der Politik - Protokolle Der Volkskammer Der Deutschen Demokratischen Republik - Pierre Bourdieus Konzeption Des Habitus - Wissens- Und Informationsmanagement - Clonal Forestry I - Das 1 — 1 Des Telefonmarketing - Die Geschlechtskrankheiten Und Ihre Bekmpfung - Erkrankungen Der Gallenblase Und Gallenwege - Die Vertriebs-offensive - Chemical Sensors - Honorarpraxis Architekten Und Ingenieure Textsammlung - Wirtschaftsstatistik Im Bachelor - Kommunikation Und Differenz - Tumormarker - Temperatur Und Leben - Diffusion Processes - Einhrung In Die Reaktionstheorie - Grundlagen Der Leistungselektronik - Kinder Zu Welchem Preis - Phase Structure Of Strongly Interacting Matter - E-branding-strategien - Netzleittechnik - Biotechnology In Japan - Ocean Space Utilization 85 - Scham Ein Menschliches Gehl - Screening Des Prostatakarzinoms - Circulation And Contaminant Fluxes In The North Sea - Italien - Grundlegende Statistik Mit R - Ich Hab Mehr Das Gesprch Gesucht - Explosive Shocks In Air - Gauge Theories Of The Strong And Electroweak Interaction - Natur Wissenschaft Und Ganzheit - Die Finanzierung Der Deutschen Einheit - Sozialpsychologische Entwicklungstheorien - Einhrung In Die Differential- Und Integralrechnung Nebst Differentialgleichungen - Insect Hormones And Bioanalogues - Rationelle Energienutzung Im Gartenbau - Rekonstruktion Von Vergangenheit - Acta Historiae Neerlandicaestudies On The History Of The Netherlands Viii - Regimes In Southeast Asia - Brain Anatomy And Magnetic Resonance Imaging - Humankologie Und Kulturkologie - Die Entwicklung Der Chemischen Technik Bis Zu Den Anfngen Der Grossindustrie Ein Technologisch-historischer Versuch - Schulverweigerung - Die Quarzlampe Und Ihre Medizinische Anwendung - Auslandsmarketing - Micturition - Rohrleitungen In Neuzeitlichen Wrmekraftanlagen - Principles Of Lasers - Erzhlen In Der Therapie - Sehnenverletzungen Und Sehnen-muskeltransplantationen - Technische Mechanik 2 - Idiopathic Hydronephrosis - Geschichte Der Homopathie - Allgemeine Und Spezielle Chirurgie Des Kopfes Einschliesslich Operationslehre Unter Besonderer Bercksichtigung Des Gesichts · Der Kiefer Und Der Mundhhle - Bestimmungsmethoden Enzyme - A Supply-side Agenda For Germany - Pediatric Body Ct - Erfahrung Und Technik In Der Produktion - Das Pendeln Bei Gleichstrommotoren Mit Wendepolen - Crystalline Bacterial Cell Surface Layers - Aktienanalyse Heute - Ideen Zu Einer Reinen Phnomenologie Und Phnomenologischen Philosophie - Biomonitoring Of Trace Aquatic Contaminants - Forschung Mit Rntgenstrahlen - Erziehung Bildung Und Geschlecht - Berufs- Und Karriereplaner Medien Und Kommunikation 20032004 - Meytechnik An Maschinen Und Anlagen - A Short Textbook Of Physics - Cerebral Blood Flow - Kinderheilkunde Und Pflege Des Gesunden Kindes Schwestern Und Sorgerinnen - Lean Production - Drehschwingungen In Kolbenmaschinenanlagen Und Das Gesetz Ihres Ausgleichs - Betriebsvorschriften Drogen- Und Gifthandlungen In Preuyen - Die Aromatischen Arsenverbindungen - –kologische Kommunikation In Deutschland - Lehrbuch Der Histologie Und Der Mikroskopischen Anatomie Des Menschen - Starthilfe Technische Mechanik - Praktisches Baustellen-controlling - Hilfsbuch Nahrungsmittelchemiker Zum Gebrauch Im Laboratorium Die Arbeiten Der Nahrungsmittelkontrolle Gerichtlichen Chemie Und Anderen Zweige Der Ffentlichen Chemie - Die Medikamentsen Seifen Ihre Herstellung Und Bedeutung Unter Bercksichtigung Der Zwischen Medikament Und Seifengrundlage Mglichen Chemischen Wechselbeziehungen - Beginning Android 4 - Didaktik Der Journalistik - Die Technik Der Negativ- Und Positivverfahren - Selbstorganisation Kooperation Zeichenprozey - Die Geschlechtliche Aufklrung Im Erziehungswerke - Aufschwung Ost - Nation Und Nationale Identitt - Korea - Perspektiven Der Kognitiven Linguistik - Mechanisms Of Chromospheric And Coronal Heating - Climate Change And Rice - Wirtschafts- Rechts- Und Sozialkunde Sekretrinnen - Vaginalsonographie Im Ersten Schwangerschaftsdrittel - Dynamisches Finanzmanagement In Der Praxis - Doping Dokumente - Raum Zeit Medialitt - Dampfturbinenschaufeln - Rheumatoid Arthritis - Hochbau Ingenieure - Die Prinzipien Der Lebensversicherungstechnik - Schlechthin Bse - Cim Lexikon - Einfaches Pharmakologisches Praktikum Mediziner - Journalistik - Die Mikroskopischen Boden-pilze - Umweltgerechte Energiepolitik - Diskurs-inszenierungen - Geschlechtsspezifische Ungleichheit Im Erwerbsverlauf - Verfahrenstechnische Grundlagen Der Lebensmitteltechnik - Pdagogik Die Kinder Stark Macht - Betriebskosten Der Verschiebebahnhfe - Digitale Signalverarbeitung Mit Matlab - Elektrische Maschinen Der Kraftbetriebe - Betriebliche Rationalisierung Und Konomische Rationalitt - Hauptwerke Der Emotionssoziologie - Hochfrequenztechnik In Funk Und Radar - Elementarteilchen - Manual Der Fetalen Medizin - Lebenslanges Lernen Im Beruf Seine Grundlegung Im Kindes- Und Jugendalter - Das Politische System Der Usa - Lehrbuch Der Hochbaukonstruktionen - Viewegs Geschichte Der Technik - Grundzge Einer Konstitutions Anatomie - Formelsammlung Wirtschaftsmathematik - Beschftigungsrisiko Erziehungsurlaub - Surface And Colloid Science - Erythropoietin - Website Marketing - Deutsche Politikwissenschaftler In Der Emigration - Henri Poincar© - Dynamik Der Leistungsregelung Von Kolbenkompressoren Und -pumpen Einschl Selbstregelung Und Parallelbetrieb - Kostenrechnung Sozialberufe - Wrterbuch Der Kraftbertragungselemente Diccionario Elementos De Transmisi³n Glossaire Des Organes De Transmission Glossary Of Transmission Elements Glossario Degli Organi Di Trasmissione Glossarium Voor Transmissie-organen Ordbok Fr Transmissionselement Voimansiirtoalan Sanakirja - Handbuch Erwachsenenbildungweiterbildung - Die Flechten Deutschlands - Jugend Privat - Modern Techniques In Computational Chemistry Moteccâ„¢ -89 - Bauauftrge Erfolgreich Akquirieren - In Deutschland Zu Hause - Herz Und Diabetes - Arbeitsbetonter Deutschunterricht Als Mittelpunkt Der Geistesbildung Im 4 Schuljahr - Friedenspolitik In Und Europa - Handbuch Der Rehabilitationspsychologie - Energieeffiziente Elektrische Antriebe - Conservation Of Living Nature And Resources - Gesenkschmiede - Investition Finanzierung Und Besteuerung - Single-channel Recording - Abwassertechnik - Atlas Der Pathologie Urologischer Tumoren - Aufschaukelung Und Dmpfung Von Schwingungen - Das Geteilte Leben - Hchstspannungs-tagung Essen - Einhrung In Die Wahrscheinlichkeitsrechnung Und Statistik Ingenieure - Wirtschaftslehre Des Handels - Isolierte Partner - Strahlenschutz An Beschleunigern - The Hla System In Clinical Transplantation - World Population Policies - O Tempora O Mores - Basic And Clinical Aspects Of Helicobacter Pylori Infection - Projektierung Und Rationalisierung Von Kohlenbergwerken - Differenzierungsfolgen - Chemical Architecture Of The Nervous System - Arbeitszeit - Zeitarbeit - Population Genetics And Evolution - Der Bankbetrieb - Chirurgische Gastroenterologie - Starthilfe Strmungslehre - Werkstoffkunde Stahl - Analytische Erkenntnistheorie - Generatives Verhalten Und Generationenbeziehungen - Pro Windows Embedded Compact 7 - We Are The Martians - Das Kniegelenk - Arbeiten Aus Dem Zahnrztlichen Institut Der Universitt Breslau - Der Krper Im Biographischen Kontext - Kurt Hahn - Gewalt Und Fremdenfeindlichkeit Jugendpdagogische Auswege - Kommunikationswissenschaft Im œberblick - The Continuum - Kritik Als Qualittskriterium Pdagogischen Handelns - Spte Mtter - Krankenpflege-lehrbuch - Das Knigliche Materialprfungsamt Der Technischen Hochschule Berlin Auf Dem Gelnde Der Domne Dahlem Beim Bahnhof Gross-lichterfelde West - Anleger An Die Brse - Das Politische System Der Bundesrepublik Deutschland Im Kontext - Die Pflegeversicherung - Allgemeine Theorie Der Menschlichen Haltung Und Bewegung - Schnittanatomie Des Menschlichen Gehirns - Informelles Regieren - Qualittsmanagement In Der Praxis - Fern-sehen Im Alltag - The Elbow - Afrika Jahrbuch 2001 - Der Westliche Universalismus - Soziale Beziehungen Im Migrationsverlauf - Therapy Of Malignant Brain Tumors - Bausteine Einer Systemischen Nachrichtentheorie - Ethics And Compliance Programs In Multinational Organizations - The Effects Of Cause-related Marketing On Customers Attitudes And Buying Behavior - Anion Carriers Of Mitochondrial Membranes - Aussage Gegen Aussage In Sexuellen Missbrauchsverfahren - Ansthesiologische Besonderheiten Bei Kindern Mit Syndromen Und Seltenen Erkrankungen - Von Pascal Zu Assembler - Theorien Der Kosmologie - Advanced Organic Chemistry - Bilanzen - Umweltbewuytsein Und Alltagshandeln - Wege Zu Effektiven Psychotherapien - Spasticity - Mittelstandsanleihen - Die Modernisierung Der Stromversorgung - Die Gestaltung Und Berechnung Von Rauchgasvorwrmern Economisern - Die Psychologie Des Verbrechens - „rger In Organisationen - Geochemistry Of Sedimentary Ore Deposits - Erdung Nullung Und Schutzschaltung - Antidiskriminierungspdagogik - Anaerobtechnik - Soziales Kompetenztraining - Politische Philosophie Im Denken Heideggers - Gesellschaftliche Probleme Als Anstoy Und Folge Von Politik - Hepatocellular Carcinoma - Die Rationelle Auswertung Der Kohlen Als Grundlage Die Entwicklung Der Nationalen Industrie - Chancen Die Erwerbsarbeit Im Alter - Die Wechselwirkung Der Physischen Krfte - Hundert Versuche Aus Der Mechanik - 85 Jahre Universittsklinik Dermatologie Und Venerologie Zrich 19162001 - Laienkompetenz Im Psychosozialen Bereich - The Permian Of Northern Pangea - Die Einphasenasynchronmotoren - Die Spt-renaissance Kunstgeschichte Der Europischen Lnder Von Der Mitte Des 16 Bis Zum Ende Des 18 Jahrhunderts - Glasschmelzfen - Der Verkappte Einheitsstaat - Kindgemyheit Im Kontext - Die Politischen Systeme Skandinaviens - Schulwesen Und Organisation - Bericht Ber Die Vierte Tagung Ber Psychopathensorge Dsseldorf - Abgrenzung Und Bewertung Von Vermgensgegenstnden - Stadtentwicklung Mit Stadtmanagement - Stahlrohrkonstruktionen - Die –ffnung Des Staates - Sensory Hair Cells - Die Elektrischen Wechselstrme - Algorithmen Zur Gefyerkennung Die Koronarangiographie Mit Synchrotronstrahlung - Blockierte Demokratien In Der Dritten Welt - Einhrung In Die Festkrperphysik - Echo-planar Imaging - Joint Ventures In Den Gus-staaten - Aktuelle Probleme Der Klinischen Strahlenbiologie - Die Methode Der Festpunkte - Netzarchitektur Kompass Die Realisierung - Technisches Optimieren - Staatsttigkeit - James Watt Und Die Grundlagen Des Modernen Dampfmaschinenbaues - Die Kunst Keine Perfekte Hrungskraft Zu Sein - Das Rztliche Gutachten - Das Problem Der Entwicklung Unseres Planetensystems - Molecular Basis Of Membrane-associated Diseases - Strmungslehre Gasdynamik Und Aerodynamisches Laboratorium - Perception Interaction And Language - Generalisierte Lungenparenchymerkrankungen - Raumdekonstruktionen - Genetics Of Fungi - Mehrgittermethoden - Politische Theorien In Russland - Boundary Integral Methods - Novel Calcium-binding Proteins - Mathematischer Einhrungskurs Die Physik - Endovaskulre Operationen Viszerale Und Renale Rekonstruktionen Gefyverletzungen - Genossenschaftliche Erziehung - Professionelles Schreiben Den Journalismus - Engagement Die Erwachsenenbildung - Hyperparathyreoidismus - Sanierung Und Facility Management - Prozessorientierte Methoden In Der Arbeits- Und Organisationsforschung - Allgemeine Konstitutionslehre - Der Rechtsstaat - Infinitesimalrechnung - Was Determiniert Wortstellungsvariation - Die Enquete-kommissionen Des Deutschen Bundestages - Ganztagsschule - Soziale Stadt Zwischenbilanzen - Geisteswissenschaften Und Wissenschaftspolitik An Der Schwelle Zum Dritten Jahrtausend - Coaching Als Maynahme Der Personalentwicklung - Hinzunehmende Unregelmyigkeiten Bei Gebuden - Trends In Applications Of Mathematics To Mechanics - œber Zahlen Und Spiele - Handbook Of Computational Solid Mechanics - Die Usa Am Beginn Der Neunziger Jahre - Zirkulationsstrungen Des Gehirns Im Serienangiogramm - Arbeitsrechtliche Gesetze - Tatort Schule Gewalt An Schulen 19941999 - Lexikon Management - Rechtsradikale Gewalt Im Vereinigten Deutschland - Kanle Gottes - Der Chirurgische Operationssaal - Geochemistry Of Marine Humic Compounds - The Fractal Company - Lebensversicherungsmedizin - Advances In Neurochemistry - Internationale Unternehmen Gesellschaft Und Verantwortung - Stress - Coole Hauer Und Brave Engelein - Afrika Jahrbuch 1989 - Pharmazeutische Technologie - Advances In Fertility Control And The Treatment Of Sterility - Periphere Osteosynthesen - Fernsehen - Self Ego And Identity - Herrschaft In Der Modernen Gesellschaft - Hilfsbuch Mineralltechniker - Die Ambulante Automatische 24-h-blutdruckmessung - Bttcherforberg Technisches Zeichnen - Die Technische Mechanik Des Maschineningenieurs Mit Besonderer Bercksichtigung Der Anwendungen - Prandtl - Hrer Durch Die Strmungslehre - Lehrbuch Der Mikrochemie - Managementorientiertes It-controlling Und It-governance - Betrieb Und Anwendung Von Leistungs- Und Regeltransformatoren - Grund- Und Wasserbau In Praktischen Beispielen - Betriebswirtschaftliche Kostenlehre - Frankreich-jahrbuch 1989 - Entwicklung Von Arbeitsorganisationen - Zwischen Sozialer Verantwortung Und Konomischer Vernunft - Fernsehjournalismus Und Die Wissenschaften - Messung Und Modellierung Paralleler Und Verteilter Rechensysteme - Synaptic Plasticity In The Hippocampus - Paul Ehrlich - Blcke Und Kokillen - Grundfragen Deutscher Wirtschaftspolitik - Fem-praxis Mit Solidworks - Kinder Zwischen Selbstsozialisation Und Pdagogik - Mit Der Richtigen Informationsverarbeitung Auf Erfolgskurs - Praktische Baustatik - Digital Audio Restoration - Sensoren In Wissenschaft Und Technik - Biographie Und Technikgeschichte - Gerechtigkeit In Der Schule - Bergschadenkunde - Doing Social Problems - Zeitgenssische Demokratietheorie - Bourdieus Theorie Der Praxis - Wohlfahrtskulturen In Frankreich Und Deutschland - Personalauswahl Ii - Einhrung In Das Prfungs- Und Revisionswesen - Size-structured Populations - Vom Wert Der Natur - Das Mediensystem Der Bundesrepublik Deutschland - Datenverarbeitung In Der Empirischen Sozialforschung - Einhrung In Die Theorie Der Schwachstromtechnik - Autarkie Und Anpassung - High-performance Scientific Computing - œber Die Rechtfertigung Wirtschaftlichen Handelns - Verkauf Von Versicherungen Und Finanzdienstleistungen Ist Keine Magie - Spinal Cord Monitoring And Electrodiagnosis - New Aspects On Respiratory Failure - Anatomie Des Menschen Ein Lehrbuch Studierende Und „rƶte - Kreditrisikotransfer - Abstrakte Modellierung Digitaler Schaltungen - Advances In Molten Salt Chemistry - Arbeitsbltter Friseure 3 - Stochastic Structural Dynamics 2 - Online-vergesellschaftung - Die Parteien Nach Der Bundestagswahl 1998 - Regionalentwicklung In Der Kommunikationsgesellschaft - Fremden Feindlichkeit - Alltgliche Lebenshrung - Die Aktive Auyen- Und Sicherheitspolitik Der Rot-grnen Bundesregierung 1998-2005 - Cochlea-implantat - Negative Versus Positive Schizophrenia - Die Psychologischen Probleme Der Industrie - Whrungsrisiken Im Portfolio - Handbuch Der Chemischen Untersuchung Der Textilfaserstoffe - Glocal Governance - Hospital Information Systems The Next Generation - Fossil And Recent Sponges - Nachhaltige Wasserbewirtschaftung - Allgemeine Und Spezielle Elektrochirurgie - Db22 Kompakt - From Data To Model - Anlagechancen 2011 - 15 Darstellungstheorie Der Endlichen Gruppen - Pdagogen In Studium Und Beruf - Stabilitt Und Wandel Von Parteien Und Parteiensystemen - Handbuch Soziodrama - Deutschland In Den Neunziger Jahren - Die Darstellung Der Bauzeichnung - Methods In Protein Sequence Analysis - A Therapist Manual For Cognitive Behavior Therapy In Groups - Kardiales Risiko Beim Sport - Atherosclerosis Vi - Organisation Und Akzeptanz - International Conference On High Energy Physics International Union Of Pure And Applied Physics 24 1988 Mnchen - Information Ergonomics - Die Hochmolekularen Organischen Verbindungen - Kautschuk Und Cellulose - - Zuwanderung In Westliche Gesellschaften - Netzwerkentwicklung In Der Jugendberufshilfe - Der Schutz Der Demokratie In Deutschland Und Frankreich - Microbially Influenced Corrosion Of Materials - Politische Diskurskulturen In Europa - Arbeitsbltter Friseure 1 - Metropolitan Governance In Deutschland - Patterns Programming And Everything - Netzwerkanstze Im Business-to-business-marketing - Das Rechnungswesen Der Kartell- Und Gruppen-wirtschaft - Outdoor-training - Europisches Management - Die Kalkulation Im Schmiedegewerbe - Berufsbildungspolitik - Berichte Des Ausschusses Versuche Im Eisenbau - Wind Turbine Noise - Solar Energy Thermal Technology - Ein Deutscher Ombudsman - Die Verhinderte Groymacht - Die Anwendung Der Nomographie In Der Mathematik - Traumatologie In Der Chirurgischen Praxis - Theorien Gesellschaftlicher Differenzierung - Die Lungenfunktion Unter Besonderer Bercksichtigung Des Wachsenden Organismus - Coronary-prone Behavior - Wissensmanagement Marketing Und Vertrieb - Kostenermittlung In Der Altbaumodernisierung - Einhrung In Die Akustik - Reden Die Die Republik Bewegten - Transportation For The Future - Wissenschaftliche Weiterbildung Als Transformationsprozey - Fernsehen Als „beziehungskiste - Organisationstheorie - Der Lastkraftwagenverkehr Seit Dem Kriege Insbesondere Sein Wettbewerb Und Seine Zusammenarbeit Mit Den Schienenbahnen - Die Staatengesellschaft Im Globalisierungsprozess - Constructional Morphology And Evolution - Direktmarketing Aus Erster Hand - Gabler Wirtschafts Informatik Lexikon - The Ichthyoses - Partitionierung Zur Effizienten Duplikaterkennung In Relationalen Daten - Steuerung Von Privatisierung - Ferdinand Graf Von Zeppelin - Die Bewegungsgruppe Einer Euklidischen Ebene - Die Lehre Vom Status Thymico-lymphaticus - Randwertprobleme Der Mikrowellenphysik - Paramecium - Religion Und Familienpolitik - Morenos Therapeutische Philosophie - Grundzge Einer Soziologie Des Musikgeschmacks - Klaus Jrgen Maack Design Oder Die Kultur Des Angemessenen - Clinical Aspects Of Blood Viscosity And Cell Deformability - Markensterben - Nahost Jahrbuch 2000 - Zerstrungsfreie Prfverfahren - Sprachloses Leid - Die Garnverarbeitung - Jahresbericht Ber Die Beobachtungs - Ergebnisse - Handbuch Parteienforschung - Die Holzbaukunst - Die Anwendung Hoher Ueberhitzung Beim Betrieb Von Dampfturbinen - Management Reporting - Politik Und Regieren In Hessen - Klinische Und Liquordiagnostik Der Rckenmarkstumoren - Information Und Wirtschaftlichkeit - Die Strafe Ii - Immobilien-management - Transport Phenomena In Porous Media - Lehrbuch Der Geisteskrankheiten - Klausuren Brgerliches Recht - Beyond The One Room School - Die Wirtschaftliche Und Soziale Lage Der Technischen Privatangestellten In Der Deutschen Elektroindustrie - Human Quality Management - Computer Und Weltbild - Aus Dem Auen-mittelwalde - Vieweg C++ Toolbox - Das Leuchten Der Organismen I - Adult T Cell Leukemia And Related Diseases - Geschichte Der Politischen Bildung In Der Bundesrepublik Deutschland 1945 198990 - Zuknftige Entwicklungen In Der Mobilitt - Drogisten-lexikon Ein Lehr- Und Nachschlagebuch Drogisten Und Verwandte Berufe Chemotechniker Laboranten Groyhandel Und Industrie - Kompendium Internistische Onkologie - Der Getreideterminhandel In Deutschland Vor Und Seit Der Reichsbrsengesetzgebung - Direct Democracy And Minorities - Kurzes Lehrbuch Der Kolloidchemie - Steuerung Unter Der Bedingung Struktureller Koppelung - Neonatal Heart Disease - Biologic Rhythms In Clinical And Laboratory Medicine - Fremde Als Ordnungshter - Customer Integration - Saunders Mac Lane Selected Papers - Die Prostitution Als Psychologisches Problem - Die Grundzge Der Werkzeugmaschinen Und Der Metallbearbeitung - Forest Dynamics - Malignant Brain Tumours - Auffallen Oder Anpassen - Die Mercerisation Der Baumwolle Und Die Appretur Der Mercerisierten Gewebe - Management-philosophie - Die Schlichtungsvcrordnung Vom 30 Oktober 1923 - Berechenbarkeit Und Unlsbarkeit - Sozialer Wandel In Ostdeutschland - Handbuch Rechtsradikalismus - Physiotherapeutisches Rezeptierbuch - Informationstechnik Kompakt - Schein Common Sense Emergency Abdominal Surgery - Auge Brille Auto - Algebraische Algorithmen - Vernetzte Sicherheit - Platelet Heterogeneity - Buchhrung Und Bilanzen - Strukturformen Und Funktionsleistungen Sozialer Systeme - Tauchtechnik - Der Kaprizise Ellbogen - Das Glyzerin - Drying Of Polymeric And Solid Materials - Prfungsvorbereitung Industriekaufleute - Gewinnen Strategien Mathematische Spiele - Digitale Signalverarbeitung - Cryotechniques In Biological Electron Microscopy - Interpretative Sozialforschung - Modernes Netzwerkmanagement - Kommunikationswissenschaft Studieren - Progress In Mathematical Programming - Bevlkerungslehre Und Bevlkerungspolitik Im „dritten Reich - The Plant Plasma Membrane - Das Recht Der Brsen - Statik Und Dynamik Der Schalen - Vorrang Der Abfallverwertung - Lehrbuch Der Geburtshilfe - Small Talk Und Karriere - Proceedings Of The Third German-italian Symposium Applications Of Mathematics In Industry And Technology - Kulturwissenschaft Als Kommunikationswissenschaft - Lehrbuch Der Speziellen Pathologie Und Therapie Der Inneren Krankheiten Studierende Und „rzte 1-30 Aufl Leipzig Fcw - Elternkurse Auf Dem Prfstand - The Economics Of Networks - Stabilitt Im Umbruch - Individualisierung - 100 Rezepte Excel 50 - Prostatitis - The Climate Of China - Vito Volterra - Aussiedler In Deutschland - Parlamente Und Systemtransformation Im Postsozialistischen Europa - Modern Trends In Virology - Auftrags- Und Projektmanagement - 25 Deutscher Soziologentag 1990 Die Modernisierung Moderner Gesellschaften - The Statistical Analysis Of Categorical Data - Hilft Die Entwicklungshilfe Langfristig - The Macula - Die Methode Der Festpunkte Zur Berechnung Der Statisch Unbestimmten Konstruktionen Mit Zahlreichen Beispielen Aus Der Praxis Insbesondere Ausgehrten Eisenbetontragwerken - Jugend Und Differenz - Fremdenfeindlichkeit Und Rechtsextremismus - Baustelle Gegenwartsliteratur - Interactive 3d Multimedia Content - Mathematica In Der Theoretischen Physik - Elemente Nachrichtentechnischer Systeme - Persnlichkeit Und Psychische Erkrankung - Agricultural Project Management - Grundinformation Recht - Jugendliche Und Drogen - Sozialpolitik In Den Usa - Handbuch Des Normalen Und Gestrten Schlafs - Der Buchmarkt Als Kommunikationsraum - Die Stahlindustrie Der Vereinigten Staaten Von Amerika In Ihren Heutigen Produktions- Und Absatz-verhltnissen - Kasuistische Beitrge Zur Modernen Pharmakotherapie Mit Quetiapin - Salben · Puder · Externa - Frauen In Der Kleinbuerlichen Landwirtschaft - Herzerkrankungen - Lokale Selbstverwaltung - Miyverstndnisse In Gesprchen - Keine Angst Vor Dem Finanzamt - Countertrade Professionell - Bestnde-controlling - Ausbildungskompass Bankkaufleute - Der Verband - Illustrirtes Repetitorium Der Pharmaceutisch-medicinischen Botanik Und Pharmacognosie - Paloanthropologie - Herz Und Kreislauf - Die Chemie Des Kautschuks - Die Akuten Infektionskrankheiten Des Kindesalters - Bodenbewirtschaftung Dngung Und Rekultivierung - Reoperative Hand Surgery - Voices Of Resilience - Attributgrammatiken - Intention Bedeutung Kommunikation - Auf Digitalen Pfaden - Der Steinkohlenbergbau Des Preussischen Staates In Der Umgebung Von Saarbrcken - Die Harnsteine - Mit Benchmarking An Die Spitze - Pathology Of The Larynx - Kundengesprche Souvern Meistern - Sap R3 Kommunikation Mit Rfc Und Visual Basic - Topics On Nonlinear Wave-plasma Interaction - Sexueller Missbrauch Mediendarstellung Und Medienwirkung - Gabler Lexikon Technologie Management - Qualitative Sichtbasierte Navigation In Unstrukturierten Umgebungen - Programmieren In C - Handlungstheorie Und Politische Kultur - Das Single - Gouvernementalitt Und Biopolitik - Virologie Am Krankenbett - Source Book Of Flavors - Bank- Und Finanzwirtschaft - Elektrische Stoyfestigkeit - Innovative Logistik - Der Wrmebergang An Strmendes Wasser In Vertikalen Rohren - Dehnungsmessungen Und Ihre Auswertung - Selektion Im Internet - Urbaner Bodenschutz - Transformationsprobleme In Ostdeutschland - Schwierige Machtverhltnisse - Insolvenzrecht - Kreditpolitik - Finanzinstrumente Im Ifrs-abschluss Von Nicht-banken - Management Jenseits Der Postmoderne - Versorgung Und Frderung Lterer Menschen Mit Geistiger Behinderung - Telekommunikation Und Jugendkultur - Sonographie Des Kindlichen Hftgelenks - Evolutionary Biology Of Transient Unstable Populations - Begriffsbildung Und Theoriestatus In Der Friedensforschung - Digitalrichtfunk - Ergebnisse Der Hygiene Bakteriologie Immunittsforschung Und Experimentellen Therapie - Die Fdp - Farbatlas Der Histologie Der Regenbogenforelle - Sportmedizin Kursbestimmung - Zur Theorie Des Absatzes - Jenseits Und Diesseits Der Betriebswirtschaftslehre - Verkehrskonomie - Zwischen Alltag Und Utopie - Bauwirtschaft - Die Angeblich Von Staatsminister Dr Delbrck Verfayte Schrift Deutschlands Getreideverkehr Mit Dem Auslande Vor Dem Forum Der Kritik - A Spider Web - Advances In Superconductivity Iv - Leitfaden Auyenwirtschaft - Der Schlaf Seine Strungen Und Deren Behandlung - Die Rztliche Ausbildung In Der Europischen Gemeinschaft - Frakturen Auf Einen Blick - Haushalt-kltemaschinen Und Kleingewerbliche Khlanlagen - Wendehorst Bautechnische Zahlentafeln - Objektives Verstehen - Das Strahlungsklima Von Arosa - Platow Prognose 2011 - Medienwandel Als Wandel Von Interaktionsformen - Trends In Control - Prozedurale Programmierung - Quark Matter - Modern Triz - Identification Of Lichen Substances - Solvomercuration Demercuration Reactions In Organic Synthesis - Motivation And Action - Der Mathematikunterricht In Der Primarstufe - Die Volkskammer Der Ddr - Stenosis Of The Cervical Spine - Dampfkesselfeuerungen Braunkohle - Modernes Personalmanagement - Kapitalismus Und Sozialismus - Lexikon Der Soziologischen Werke - Vermgen In Sicherheit - Das Verbrechen I - Sexual Plant Reproduction - Identitt Und Rolle - Innovations In Abdominal Ultrasound - Optimierung Von Deponieabdichtungssystemen - Krieg Als Medienereignis Ii - Ultraschall Wird Lesbar - Die –lfeuerungstechnik - Java 7 Recipes - Beziehungen In Der Jugendarbeit - Kleists Geheimnisse - Rating Scales For Psychopathology Health Status And Quality Of Life - Optionsscheine Optionen Und Futures - Ein Biychen Feministisch Anwendungsorientierte Sozialforschung - Technische Thermodynamik - Wirtschaftlichkeit Von Rfid-systemen In Der Logistik - Leitfaden Den Bau Von Kleinwasserkraftanlagen - –konomie Der Werbung - Die Werkzeugmaschinen - Distributed Autonomous Robotic Systems 3 - Kompressoren-anlagen - Lehrbuch Der Physik - Geschichte Der Bergbau- Und Httentechnik - Bericht Ber Die Zweite Tagung Ber Psychopathensorge - Solution Chemistry Of Surfactants - Die Rntgendiagnostik Der Intrathorakalen Tumoren Und Ihre Differentialdiagnose - Social Dilemmas And Cooperation - Smarte Innovation - Gleichgewicht Und Reibungslose Bewegung - Optical Characterization Of Epitaxial Semiconductor Layers - Grenzgnger - Ertragstafeln Reine Und Gleichartige Hochmaldbeftnde Von Eiche Buche Tanne Fichte Kiefer Grner Douglafie Und Lrche - Die Ersten 25 Jahre Der Deutschen Gesellschaft Chirurgie - Gynkologie Und Geburtshilfe 1994 - Grundbildung Kaufleute - Die Pathologische Anatomie Der Familie - Optimization For Industrial Problems - Herrschaftstheorien Und Herrschaftsphnomene - Evolution By Gene Duplication - Inflation Und Geldentwertung - Toward The Factory Of The Future - Essentielle Spurenelemente In Der Nahrung - Altersbilder Und Altenhilfe - Aufbau Betrieblicher Informationssysteme - Renditechancen 2011 - Insuring And Managing Hazardous Risks From Seveso To Bhopal And Beyond - Neutrino - Design Methods For Digital Systems - Geschichte Studieren - Advances In Superconductivity Iii - Die Absatztechnik Der Amerikanischen Industriellen Unternehmung - Tragwerke Hochbauten - Decompiling Android - Angiographie Der Hand - Quantum Mechanics Using Maple - Technische Zivilisation - Grundkurs Microsoft Dynamics Ax - Brand- Und Explosionsschutz Von A-z - Die Anfertigung Forstlicher Terrainkarten Auf Grund Barometrischer Hhenmessungen Und Die Wegnetzprojectirung - Elektromechanische Schaltungen Und Schaltgerte - Health Care Evaluation Using Computer Simulation - A Textbook Of Medical Practice - Earth Rotation From Eons To Days - Medienwelten Im Wandel - Progressive Muskeldystrophie Myotonie · Myasthenie - Baustatik - Die Enttuschten Revolutionre - Seniorenpolitik Aus Der Akteursperspektive - Umwelt Zur Sprache Bringen - Standardisierte Krebsbehandlung - Elastische Platten - Chronik Der Kinderradiologie - Design And Simulation Of Spectrum Management Methods For Wireless Local Area Networks - Gyrodynamics - Spannweite Der Gedanken - Probleme Aus Der Physik - Die Instrumentelle Perforation Des Graviden Uterus Und Ihre Verhtung - Bilanzpolitik Und Kreditvergabeentscheidungen - Schweiyen Und Lten Mit Festkrperlasern - Die Entwicklung Der Kaltsgemaschinen Von Ihren Anfngen Bis In Die Neueste Zeit - Projekt- Und Investitionscontrolling Mit Sap R3 - Applications Of Laser Anemometry To Fluid Mechanics - Gender Medienkompetent - Erluterungen Zu Den Vorschriften Elektrische Bahnen Bahnvorschriften - Post-lesion Neural Plasticity - Die Abenteuer Des Anselm Wytegern - Computergraphik Und Bildverarbeitung - Die Arbeitenden Klassen Englands - Bau Und Eigenschaften Der Organischen Naturstoffe - Verkaufserfolge Steuern Und Optimieren - Regieren In Der Bundesrepublik Iii - Experiment Bei Gegenwind - Informatik - Stochastik Der Strahlenwirkung - Schriftlichkeit Und Gesellschaft - Economic Transformation In Eastern Europe And East Asia - Grundlagen Von Informationssystemen - Sozialpsychologisches Organisationsverstehen - Salt And Hypertension - Re-design Von Wertkette Durch Make Or Buy - Wohlfahrtsstaatliche Politik In Jungen Demokratien - Mathematik-vorkurs - Sonographische Diagnostik In Der Unfallchirurgie - Bauordnung Berlin - Panic And Phobias 2 - Sexualisierte Gewalt - Bildung Neu Denken! Das Zukunftsprojekt - Politik In Sachsen - Englisches Konversations-buch Pharmazeuten - Jugend Freizeit Geschlecht - Bausteine Ein Zukunftsfhiges Deutschland - Helicobacter Pylori And Gastroduodenal Pathology - Bildungserfahrungen An Waldorfschulen - Der Zahnlose Unterkiefer - Die „nderungen Der Sozialen Versicherungsgesetze Seit Ausbruch Des Krieges - Die Empirisch-wissenschaftliche Sicht - Aesthetic And Reconstructive Otoplasty - Regieren In Der Bundesrepublik V - Love As Pedagogy - Institut X - Das Neue Arbeitsrecht - Der Harn Sowie Die Brigen Ausscheidungen Und Krperflssigkeiten - Industrielle Betriebshrung - Das Messen Mit Elektrischen Gerten - Im Umgang Mit Der Macht - Muttersprache Vaterland - Lehrbuch Der Elektrochemie - Lean Management In Krankenhusern - Acid Deposition Environmental Economic And Policy Issues - Allgemeines Und Gaskatalyse - Geometrische Methoden In Der Theorie Der Gewhnlichen Differentialgleichungen - Formen Der Eigenarbeit - Bildungserfahrungen An Montessorischulen - Superfine Particle Technology - Gewalt Und Geschlecht - Die Chemischen Processe Und Stchiometrischen Berechnungen Bei Den Prfungen Und Wertbestimmungen Der Im Arzneibuche Das Deutsche Reich Vierte Ausgabe Aufgenommenen Arzneimittel - Fit Nachhaltigkeit - Frankreich-jahrbuch 2002 - Die Entwicklung Der Zahnrad-technik - Katheterablation Supraventrikulrer Tachykardien - Frauen Das Kranke Geschlecht Mythos Und Wirklichkeit - Fallsammlung Steuerlehre Rechnungswesen - Aal- Und E-health-geschftsmodelle - Biological Coherence And Response To External Stimuli - Bildungsgerechtigkeit Jenseits Von Chancengleichheit - Aachener Bausachverstndigentage 2006 - Geldanlage In Steueroasen - Grundwissen Sozio-marketing - Nuclear Technologies In A Sustainable Energy System - Die Maske Der Scham - Radiologie Trger Des Fortschritts - Syntax Des Gesprochenen Deutsch - Atlas Of Brain Mapping - Grundriss Der Hygiene - Schreiben In Werbung Pr Und Journalismus - Parteien In Frankreich - Einhrung In Die Lehre Von Der Wrmebertragung - The Course Of Eating Disorders - Neukundengewinnung Durch Dialogkommunikation - Ultrafast Mri - Practical Issues In Anesthesia And Intensive Care - Chinas Lndliche Gesellschaft Im Umbruch - Einhrung In Die Baustatik - Rechnen An Spanenden Werkzeugmaschinen - Unbewuyte Selbstbilder - Sucht Und Familie - Aufgaben Physikalische Schlerbungen - Empirisch Begrndete Typenbildung - Perspektiven Der Medienkritik - Amerikanische Heizungs- Und Lftungspraxis - Mathematical Modeling And Scale-up Of Liquid Chromatography - Krebs Und Unfall - Lehrbuch Der Allgemeinen Humangenetik - Die Pflanzliche Zellwand - Tops 10 - Der Jungunternehmer - Ingenieur-mathematik - Nonlinear Dynamical Economics And Chaotic Motion - Kultursoziologie - Die Kunst Der Innovation - Politische Steuerung Durch Sanktionen - Parteiendemokratie In Deutschland - Lehrbuch Der Drahtlosen Telegraphie - Anxiety And Depression In Children And Adolescents - Der Dimorphismus Der Wahrheit - Gesammelte Abhandlungen Zur Funktionellen Anatomie Des Bewegungsapparates - Kinderpsychotherapie In Der Praxis - Perspektiven Auf Kindheit Und Kinder - Die Nebennierenrinde Im Kindesalter - Lehren Und Lernen In Der Beruflichen Erstausbildung - Fortschritte Der Serologie - Die Psychoanalyse - Parteien Kulturen Und Konflikte - Grundlagen Des Marketing - Grenzen Virtueller Gemeinschaft - Ermdungsrisse - Mathematik Ingenieure Und Naturwissenschaftler Band 2 - Erektile Funktionsstrungen - Kaffee Und Koffein - Virology And Immunology In Multiple Sclerosis Rationale For Therapy - Der Eva Als Management- Und Bewertungsinstrument - Business Process Modelling - The Tropical Rain Forest - Das Kriegsgeschehen 2001 - Bilanz Mit Aussichten - Objektorientierte Programmierung In Java - Langsamkeit Entdecken Turbulenzen Meistern - Experteninterviews - Sport Und Krperliche Aktivitt In Der Onkologie - Datenreport Erziehungswissenschaft - Proceedings Of An International Conference On Dynamic Crack Propagation - Blood Supply Of Bone - Platow Prognose 2012 - Gaba Outside The Cns - Isdn The Integrated Services Digital Network - Learn Electronics With Arduino - Die Selbstanzeige In Der Praxis - Soziologische Theorie Und Empirie - Einhrung In Die Pathologische Physiologie - Hhere Mathematik 1 - Beginning Db2 - Aufbruch In Ein Gemeinsames Altern - Allgemeine Physiologie - Erziehungswissenschaft - Das Prinzip Unschrfe - Gene Transfers And Environment - Handbuch Europa In Nordrhein-westfalen - Bauten Aus Beton- Und Stahlbeton-fertigteilen - Alterations Of Chemical Equilibrium In The Nervous System - Initial Boundary Value Problems In Mathematical Physics - Reiseverkehrsgeographie - Handbuch Der Schweiytechnik - Lgner - Due Diligence In Der Praxis - Regel-transduktoren - Werkstoffe Der Elektrotechnik - Neue Finanzdienstleistungen - Mind The Gap! - Altersvorsorge Am Scheideweg - Streitbare Demokratie Und Innere Sicherheit - Querschlger - Betrachtungen Eines In Deutschland Reisenden Deutschen - Die Integration Von Theorie Und Methode In Der Netzwerkforschung - Das Schmiedbare Eisen - Modalitt Im Deutschen - Pdagogik Des Mathematikunterrichts - Lebensqualitt - Aufgaben Und Lsungen Die Bilanzbuchhalterprfung - œbertragungsverhalten Analoger Schaltungen - Die Internationale Bauausstellung Emscher Park - Fehler Und Fehlerkultur Im Krankenhaus - The World Of Peptides - Eliten Macht Und Konflikt In Der Bundesrepublik - Soziologie Des Selbstmords - Religion Bei Meinungsmachern - Gespaltene Jugend - Anton Dohrn - Handbuch Der Experimentellen Pharmakologie - Mri In Der Gynkologie Und Geburtshilfe - Logistik Und Qualittsmanagement Im Gesundheitsbetrieb - –konomie Der Medien Und Des Mediensystems - Scientific Literacy - œberblicke Mathematik 199697 - Datenbank-engineering - Lehrbuch Der Ohrenheilkunde - Gerechtigkeit Diskurs Oder Markt - Deskriptive Statistik Und Moderne Datenanalyse - Principles Of Wood Science And Technology - Qualitt In Der Sozialen Arbeit - Bild Und Wirklichkeit - Modeling And Managing Shallow Lake Eutrophication - Erluterungen Zu Den Sicherheitsvorschriften Die Errichtung Elektrischer Starkstromanlagen Einschliesslich Der Elektrischen Bahnanlagen - Die Zukunft Kommt Wohin Geht Die Wirtschaft - Gruppentherapie Mit Kindern - Green Solvents Ii - Life Under Extreme Conditions - Fundamentals Of Power Electronics - Entwurf Analoger Und Digitaler Filter - Gustav Adolf Hirn Sein Leben Und Seine Werke - Bankrisikomanagement - Die Periphere Schmerzauslsung Und Schmerzausschaltung - Die Krankheiten Des Herzens Und Der Gefsse - Innovation Macht Schule - Imaging Of The Brain In Psychiatry And Related Fields - Chemisch-botanischer Leitfaden Zollbeamte - Hauptfragen Der Reichsbahnpolitik - Surgery Of Basal Cell Carcinoma Of The Face - Liebeserklrungen - Optical Signal Processing - Neue Wege Der Betrieblichen Planung - Justizberichterstattung - Nutrition Diet And Cancer - Komplexe Zahlen Und Zeiger In Der Wechselstromlehre - Opus Dei Und Scientology - Messen Steuern Und Regeln In Der Chemischen Technik - Parlamentarische Mitsteuerung - Die Erkrankungen Der Schilddrse - Denklchrift Ber Das Ffentliche Gesundheitswesen Helgolands Die Jahre 18861889 - Handbuch Zur Visuellen Diagnose Von Ernhrungsstrungen Bei Kulturpflanzen - Biology Of The Vespine Wasps - Schtze Und Schtzensteuerungen - Der Gift- Und Farbwaaren-handel - Psychiatrie Der Verfolgten - Neurologische Untersuchung Und Diagnostik Im Kindesalter - Die Inszenierung Des Neubeginns - Das Strayenkinderprojekt Als Organisation - Tensor Analysis And Continuum Mechanics - Corporate Governance Und Managementberatung - Magnetic Resonance Imaging - The Nordic Seas - Geschftsbereichsorganisation - Geologie Der Landschaft Um Wien - Die Industrielle Keramik - Eu-beitritt Verheiyung Oder Bedrohung - Lehrbuch Der Bergwirtschaft - Aktive Kundenbeziehungen Mit Crm - Progress In Precision Engineering - Handbuch Der Normalen Und Pathologischen Physiologie Fortpflanzung Entwicklung Und Wachstum - Bschungen Und Baugruben - Pflege Im Wandel Gestalten Eine Hrungsaufgabe - Trace Elements In Clinical Medicine - Europische Geschichte Und Politik 18711881 - Demokratie In Deutschland - Der Konstruktive Fortschritt - Marken-power - Tops 09 - Die Versorung Der Familie - Japan Europa Usa - Der Industriebau - Expert Systems In Engineering Applications - Die Bankgehilfenprfung In Programmierter Form - Die Statik Des Ebenen Tragwerkes - Fachrechnen Raumausstatter - Dynamik Der Kraftfahrzeuge - Innovative Unternehmenskommunikation - Transition Metals And Organometallics As Catalysts For Olefin Polymerization - Verfassungsrecht Und Verfassungswirklichkeit Im Vereinigten Deutschland - Erziehung Im Sozialen Umfeld - Als Kontrolliert Wurde Was Mit Dem Taler Geschah - Fluid- Und Wrmetransport Wrmebertragung - Leitfaden Geometrie - Chemical Water And Wastewater Treatment Ii - Interaction Between Mental And Physical Illness - Lunge-berl Chemisch-technische Untersuchungsmethoden - Die Strafzumessung - Die Auswirkungen Der Nachhaltigkeitsberichterstattung Auf Den Kapitalmarkt - The Knee And The Cruciate Ligaments - Modern Methods For Epidemiology - Sende- Und Empfangsdioden Die Optische Nachrichtentechnik - Das Seltsame Problem Der Weltgesellschaft - [email protected] - Winner Edge Konzepte Vorsprung - Neue Unterhaltsame Astronomie - Druck Von Textilien - Politikberatung Parteien - Der Psychologische Test - Produktion Als Wettbewerbsfaktor - Unberechenbare Umwelt - Modell Zur Bewertung Wohnwirtschaftlicher Immobilien-portfolios Unter Beachtung Des Risikos - Freundschaften Cliquen Und Jugendkulturen - Einhrung In Die Chemische Physiologie - Prvention Familien Mit Psychisch Kranken Eltern - Begabtenfrderung Im Gymnasium - Grundkurs Soziologie - Risikoorientierte Bauprojekt-kalkulation - Der Steuerungs- Und Wohlfahrtsstaat Deutschland - Erfahrungen Mit Schiffsdieselmotoren - Datenstrukturen Objektorientiert Mit Modula-2 - Das Neue Pli - Geschichte Der Politikwissenschaft - Der Geologische Aufbau –sterreichs - Wettlauf Um Die Alten - Eisenbahnoberbau - Statistics Applied To Clinical Studies - Altsein In Deutschland - Bird Migration - Atlas Of Electroencephalography In Sleep Medicine - Sagen Und Meinen - Dtp-praxis Mit Pagemaker 5 - Expertensysteme 87 Konzepte Und Werkzeuge - Professionalisierung Der Politikvermittlung - Indizes In Der Vergleichenden Politikwissenschaft - Chemie Des Ingenieurs - Die Akute Mittelohrentzndung - Politische Steuerung - Wohlfahrtsstaat Transformation Und Perspektiven - Rate Adaptive Cardiac Pacing - –ffentlichkeit Und Vertraulichkeit - Kombinationsgerbungen Der Lohe- Weiy- Und Smischgerberei - Grundkurs Wirtschaftsmathematik - Investigative Urology 3 - Die Verfahren Der Plastischen Berechnung Biegesteifer Stahlstabwerke - Systemwechsel 3 - Imaging Techniques In Orthopaedics - Die Psychogenen Reaktionen Einschlieylich Der Sogenannten Entschdigungsneurosen - Materialtheorie - Gerontology - Der Grundbau - Platow Prognose 2010 - Tragende Kunststoffbauteile - Computer Animation 90 - Beginning Teaching - Duration And Change - Parteiorganisation Im Wandel - Kugelpackungen Von Kepler Bis Heute - Mechanisches Verhalten Der Werkstoffe - Inszenierte Information - Delphi Essentials - Stereoselective Synthesis - Der Junge Drogist - Mathe-manga Analysis - Leitfaden Der Rundfunkentstrung - Myelin Repair And Neuroprotection In Multiple Sclerosis - Rckreise In Die Vergangenheit - Verliebt Verlobt Verheiratet - Antisemitismus In Der Bundesrepublik Deutschland - –kologische Linguistik - Die Versorgung Des Brandverletzten Im Katastrophenfall Band 2 - Anatomie Und Technik Der Leitungsansthesie Im Bereiche Der Mundhhle - Gerichtsrztliche Untersuchungen - Die Bedeutendsten Mrtelbildner In Deutschland - Herausforderung Risikomanagement - Technique Of Internal Fixation Of Fractures - A Politics Of Inevitability - Neue Impulse In Der Hochschuldidaktik - Objektorientierte Programmierung Mit Turbo Pascal - Neuere Anstze Zur Diagnostik Und Therapie Schizophrener Minussymptomatik - Regulation Of Coronary Blood Flow - Wer Ist Fremd - Management Und Bilanzierung Von Emissionsrechten - Der Wandel Der Chinesischen Auyenpolitischen Interessenstruktur Seit 1949 - Berufsbiografie Und Familiengrndung - Alles Was Sie Ber Marken Wissen Mssen - Fuchs-aktuell Vermgensmanagement Mit Etfs - Wissenschafts- Und Erkenntnistheorie - Das Prinzip Nation In Modernen Gesellschaften - Language Engineering - Caspar Neher Der Gryte Bhnenbauer Unserer Zeit - Practical Knowledge-based Systems In Conceptual Design - Mathematische Analyse Des Raumproblems - Soziale Arbeit Und Demokratie - Die Reorganisation Der Fabrik Und Die Wiederentdeckung Der Arbeit - Lebensstile Durch Werbung - Diagnostik Und Therapeutische Indikationsstellung Bei Den Chirurgischen Erkrankungen Der Harnorgane - Erfolgsstrategien Zulieferer - „sthetik Im Prozey - Die Wirksamkeit Der Entwicklungshilfe - Wirtschafts- Und Sozialkunde Versicherungsfachangestellte - Algebra I - Jugenden Soziale Ungleichheit Und Werte - Anatomie Des Menschen Ein Lehrbuch Studierende Und „rƶte - Aachener Bausachverstndigentage 2001 - Soziale Determinanten Des Drogengebrauchs - Organisation - Neutrino Physics - Nachrichten-journalismus - Weberei - Grundstze Ordnungsmyiger Unternehmensbewertung - Frauen In Den Naturwissenschaften - Nierentransplantation - Assisted Circulation 4 - Philosophieren Mit Kindern - Bandstrayen Im Baubetrieb - Karriere In Der Finanzwelt - Handbuch Der Internationalen Politik - Schlsselwerke Die Kommunikationswissenschaft - Die Deutsche Gesellschaft In Vergleichender Perspektive - Monitoring And Mitigation Of Volcano Hazards - Gender Mainstreaming In Sachsen-anhalt - Elementare Differentialgeometrie Mit Maple - Stoffliche Nutzung Nachwachsender Rohstoffe - Mngelansprche Nach Vob Und Bgb - Elektronische Datenverarbeitung - Redefining The Process Of Retirement - Natur Als Grundlage Und Ziel Der Wirtschaft - Internationales Steuerrecht - Law In The Making - Das Mathematica Arbeitsbuch - „rztliche Gesprchsausbildung - Risk Assessment Of Prenatally-induced Adverse Health Effects - Die Lehre Vom Wirtschaftsbetrieb Allgemeine Betbiebswirtschaftslehre - Vertrauen In Organisationen - Signalanalyse - Learn Cocoa Touch For Ios - Die Selbstkostenberechnung Im Fabrikbetriebe - Forecasting Oracle Performance - Unternehmenscontrolling - Die Knstliche Seide - Gewinne Einkaufen - Das Kristallzeichnen Auf Grundlage Der Stereographischen Projektion - Aktuelle Neuropdiatrie 1990 - Elektrische Gasentladungslampen - Einhrung In Die Politischen Theorien Der Gegenwart - Berechnungsverfahren Zur Bestimmung Der Kritischen Drehzahlen Von Geraden Wellen - Die Regierbare Stadt - Lokale Engagementfrderung - Estriche Und Bodenbelge - Enzymologie - Rechtsbewusstsein In Der Demokratie - Timssiii Dritte Internationale Mathematik- Und Naturwissenschaftsstudie Mathematische Und Naturwissenschaftliche Bildung Am Ende Der Schullaufbahn - 101 Frauen Der Deutschen Wirtschaft - Gesundheitskommunikation - Form Und Funktion Sozialer Netzwerke In Wirtschaft Und Gesellschaft - Fundamentals Of Plant Breeding - Berechnung Entwurf Und Betrieb Rationeller Kesselanlagen - Berliner Szenetreffpunkt Bahnhof Zoo - Geologische Voraussetzungen Wasserkraftanlagen - Prekrer œbergang In Den Ruhestand - Angewandte Soziologie - Analytical Methods In Software Engineering Economics - „rztliches Handbchlein Hygienisch-ditetische Hydrotherapeutische Mechanische Und Andere Verordnungen - Blaue Hemden Rote Fahnen - Bacterial Adhesion - Klinische Arterienpulsschreibung - Suspended Matter In The Aquatic Environment - Demokratie Und Verein - Der Kinderwunsch Aus Psychologischer Sicht - Multicellular Animals - Mikrosoziologie - Die Vlker Der Ehemaligen Sowjetunion - Personalpolitische Handlungsalternativen Mit Lteren Arbeitnehmern In Unternehmen Vor Dem Hintergrund Der Demographischen Entwicklung In Deutschland - Ngos Als Legitimationsressource - Automobilrecycling - Methoden Der Regionalen Fernerkundung - Dialogmarketing Perspektiven 20112012 - Einhrung In Die Funktionale Programmierung Mit Miranda - Heterogene Katalyse Ii - Baustoffe Tragende Bauteile - Animal Acoustic Communication - Durch Die Usa Und Canada Im Jahre 1887 - Hochfrequenzmesstechnik - Distributionslogistik - Laue Atlas - Vertigo - Leitsymptom Schwindel - C A Bjerknes - A History Of The Royal College Of General Practitioners - Technik Aus Soziologischer Perspektive - Qualittssicherung Durch Softwaretests - Die Krankheiten Der Endokrinen Drsen - Praktische Numerik Mit Mathematica - Auto Und Verkehr Bis 2000 - Nbd-prognosemodelle Im Kundenbeziehungsmanagement - Der Deutsche Bundestag Im Wandel - Kants Friedensschrift Und Der Theorienstreit In Den Internationalen Beziehungen - Der Sugling - Experimental Cardiovascular Diseases - Blood Pressure Measurements - Opportunismus In Geschftsbeziehungen - Die Gewinde Ihre Entwicklung Ihre Messung Und Ihre Toleranzen - Neue Medien Im Alltag - Eine Neue Bildungsfinanzierung - Milieu Urbanitt Und Raum - Vom Nil Zum Neckar - Handbuch Spannungs Messpraxis - Einhrung In Die Technische Schwingungslehre - Der Konstitutionstypus Als Genetisches Problem - Politikwissenschaft - E-learning - Nuclear Electronics - Practice Questions In Psychopharmacology - Die Werksgemeinschaft In Historischer Und Soziologischer Beleuchtung - Solare Technologien Gebude - The Future Of Vocational Education And Training In A Changing World - Einheit Durch Vielfalt - Modern Clinical Molecular Techniques - Innovationspotentiale In Der Produktentwicklung - Jg=tafel Luft Und Verbrennungsgase - Spi Plastics Engineering Handbook Of The Society Of The Plastics Industry Inc - Gewerbestaub Und Lungentuberkulose Stahl- Porzellan- Kohle- Kalkstaub Und Ruy Eine Literarische Und Experimentelle Studie - Elektrotechnik Mit Basic-rechnern Sharp - Wer Dient Verdient! - Die Praxis Der Physikalischen Therapie - Differentialdiagnose Seltener Lungenerkrankungen Im Rntgenbild - Alterssportmedizin - Moderne Lern-zeiten - Waste Management - Psychoanalytisches Wissen - Dv-controlling Bei Finanzdienstleistern - Hydromechanik Der Gerinne Und Kstengewsser - Praxisorientiertes Online-marketing - Zement - Medienrezeption Als Aneignung - Die „tiologie Der Syphilis - Praxishandbuch Presse- Und –ffentlichkeitsarbeit - Der Diabetes Mellitus - Das Sternsystem - Media Manager - Elektrische Energieerzeugung - Therapeutic Antibodies - Die Europische Zentralbank - Abwanderung Und Migration In Mecklenburg Und Vorpommern - Die Macht Der Reprsentation - Hippokrates - Sprechwissenschaft And Psycholinguistik 5 - More Ios 6 Development - Fetal Growth - Das Sputum - Advances In Autonomous Mini Robots - Gps For Geodesy - Plasmaphysik Physiker - Adaptability - Handwrterbuch Des Konomischen Systems Der Bundesrepublik Deutschland - Cg International 90 - Atome Molekle Kerne - Testosterone - Das Deutsche Parteiensystem - Kommunikation Und Verstndigung - Demokratiequalitt In –sterreich - Gegenbilder - Handbuch Des Wissenschaftstransfers - Party-voter Linkage In Africa - Chronik Des Deutschen Forstwesens Im Jahre 1888 - Hilfsbuch Den Apparatebau - Practical Html5 Projects - Irrtum Und Wahrheit Ber Wasserkraft Und Kohle - Global Governance Und Ngos - Arbeitsmethoden Der Technikwissenschaften - Die Grundgesetze Der Wrmebertragung - Recent Progress In The Chemical Synthesis Of Antibiotics - Color Atlas Of Surgical Anatomy For Esophageal Cancer - Research Techniques For High Pressure And High Temperature - Betrachtungen Ueber Abfluss Stau Und Walzenbildung Bei Fliessenden Gewaessern Und Ihre Verwertung Die Ausbildung Des œberfalles Bei Der Untertunnelung Der Sihl Durch Die Linksufrige Seebahn In Der Stadt Zrich - Flood Response And Crisis Management In Western Europe - Der Baugrund - Die Globale Wettbewerbsstrategie - Nachhaltigkeit - Verstrkertechnik - Bevlkerungsfragen Auf Abwegen Der Wissenschaften - Identittsbasierte Markenhrung Professioneller Sportvereine - Benzodiazepines And Therapeutic Counselling - Physical Property Prediction In Organic Chemistry - Calcium Metabolism Bone And Metabolic Bone Diseases - Vergabepraxis Auftragnehmer - Bildungsentscheidungen Als Sozialer Prozess - Multiple Criteria Decision Support In Engineering Design - Das Konzept Der Solidaritt - Chancen Fouls Und Abseitsfallen - Manual Of Disaster Medicine - Regieren In Der Bundesrepublik Ii - Grundprinzipien Der Mechatronik - Arends Volkstmliche Namen Der Drogen Heilkruter Arzneimittel Und Chemikalien - Elektrotechnische Meykunde - Grungschemisches Praktikum - A Guide To Drugs In Current Use - Fortschritte Der Theerfarbenfabrikation Und Verwandter Industriezweige - Funktionale Grammatik Und Sprachbeschreibung - Palliative Krebstherapie - Economic Aspects Of German Unification - Unternehmenshrungslehre - Reiseziel Frankreich - Atlas Of Fine Needle Aspiration Cytology - The Endocrine Control Of The Fetus - Laser Lithotripsy - Energierecht - Der Edisonakkumulator - River Dynamics And Integrated River Management - Die Serse Entzndung - Funktionsprufung Innerer Organe - Im Zeichen Des Umbruchs - Das Fernstrassenproblem Europas - Strukturwandel Internationaler Beziehungen - Bewegungstherapie In Der Kardiologie - Secondary Algebra Education Revisiting Topics And Themes And Exploring The Unknown - Cooperative Phenomena - Marktstrategisches Kreislaufmanagement - Familienunternehmer Heute - Mineralle Und Verwandte Produkte - Endosonography In Obstetrics And Gynecology - Teilhabe An Der Gesellschaft - Die Arzneimittel-synthese Auf Grundlage Der Beziehungen Zwischen Chemischem Aufbau Und Wirkung - Ethical Issues Of Molecular Genetics In Psychiatry - Die Herzogthmer - Frischoperiertenstation Und Intensivpflege - Meygerte Und Schaltungen Wechselstrom-leistungsmessungen - Das Prfungsbuch - Wohnen Im Wandel - Zur Genealogie Des Politischen Raums - Privatschulen Versus Staatliche Schulen - Hydrotherapie Im Hause Des Kranken - Die Genaue Berechnung Von Trgerrosten - Information Und Gestaltung - Glubiger Schuldner Arme - Institutionelle Kommunikation - Englands Privat- Und Handelsrecht - Vorsprung Durch Sympathie - Deutschland Nach Den Wahlen - Existential-phenomenological Perspectives In Psychology - Der Regierungsbezirk Hannover - Managing Business Portfolios Effectively - Europawahl 2004 - Dynamics In One Complex Variable - Reducing Co2 Emissions - Technischer Lehrgang Ventile - Peptides As Probes In Muscle Research - Kurze Anleitung Zur Appretur-analyse - Handbuch Wissenschaftssoziologie - –ffentlichkeit Als Prozey - Finanzierung Und Frderung Von Kinospielfilmen In Deutschland - Schule Und Beruf - Corneal Sensitivity - Illustrierte Flora Von Nord- Und Mittel-deutschland - Kostbarkeiten Aus Dem Deutschen Apotheken-museum Heidelberg Treasures From The German Pharmacy Museum Heidelberg - Recent Advances In Management Of Digestive Cancers - The Decade Of Medicine Or The Physician Of The Rich And The Poor - Publizieren Whrend Der Promotion - Empirische Sozialforschung Und Gesellschaftliche Praxis - Messen Steuern Und Regeln Mit Iconnect - Entwicklung Paralleler Betriebssysteme - Konforme Abbildung - Die Tierwelt Der Alpen - Ewige Kalender - Die Nordwestdeutsche Heide In Forstlicher Beziehung - Weltordnungspolitik - Sectional Fetal Anatomy In Ultrasound - Operations Research In Production Planning And Control - International Skeletal Society Membership Book - Das Veranschlagen Von Hochbauten Nach Der Dienstanweisung Die Lokalbaubeamten Der Staats-hochbauverwaltung Einschlieylich Der Neuesten Vorschriften Das Garnisonbauwesen Sowie Die Normen Die Fabrikation Und Lieferung Von Baumaterialien Und Die Baupreise - Agency Theory Information And Incentives - Handbuch Der Physik - Bwl Ingenieure - Demokratie Und Auyenpolitik In Lateinamerika - Advances In Human Genetics 10 - Theoretical Physics On The Personal Computer - International Yearbook Of Nephrology 1992 - Grundlagen Der Chemotherapie - Clays In Crustal Environments - Wissensmanagement Die Veranstaltungsbranche - Biochemische Grundlagen Der Disposition Karzinom - Handbuch Der Metallmrkte - Die Gruppendiskussion In Der Marktforschung - Betriebswirtschaftslehre Und Konomische Krise - Images In Mobile Communication - Anders Leben - Anders Sterben - Die Vervielfltigung Von Zeichnungen Insbesondere Von Technischen Zeichnungen - Beratung Coaching Supervision - Advances In Econometrics Income Distribution And Scientific Methodology - Analyse Und Simulation Elektronischer Schaltungen - Drogenhilfe Und Graumarkt - Albert Einstein Wirkung Und Nachwirkung - Mitarbeitermotivation Im Outsourcing Unter Besonderer Bercksichtigung Des Facility Managements - Computation Of Biomolecular Structures - Hydergine - Verkaufen Mit Offenen Ohren - Neue Soziale Risiken Und Soziale Arbeit In Der Transformationsgesellschaft - Cranioplasty - Der Nachrichtenwert Im Situativen Kontext - Politische Parteien Im Demokratisierungsprozess - Die Reichseisenbahnen - Produktentwicklung In Der Automobilindustrie - Explosion Pipes - Festverzinsliche Optimal Managen - Medical Applications Of Microcomputers - Einhrung In Die Programmiersprache Simula - Jahrbuch Verkaufstraining 9899 - Chemische Analysen Mit Dem Polarographen - Studien- Und Forschungshrer - Soziales Deutschland - Management Gurus - Musiksoziologie In Der Bundesrepublik Deutschland - Geschichte Des Deutsch-franzsischen Krieges 1870 Und 1871 - Zivilisationswende - Das Verchromungs-verfahren - Umweltbelastungen Und „ngste - Edvcad Die Bautechnik - Konkurrierende Generationen Auf Dem Arbeitsmarkt - Bioproducts And Bioprocesses - Die Pubertt - Aktuelle Neuropdiatrie 1989 - Surgical Endodontics - Disorder Effects On Relaxational Processes - Wrme- Und Klteschutz - Berlin Was Ist Uns Die Hauptstadt Wert - Die Stimme Der Medien - Der Antagonismus Frankreichs Und Englands Vom Politisch-militairischen Standpunkte Und Die Wahrscheinlichkeit Einer Franzsischen Truppenlandang Auf Der Englischen Sdkste - Air Pollution Modeling And Its Application Vii - Sozialer Umbruch Und Kriminalitt In Deutschland - Operations Research Im Bauwesen - Die Ffentliche Begrndung Politischen Handelns - Wem Dient Der Auswrtige Dienst - Carl Friedrich Gauss Werke - Atlas Of Nuclear Cardiology - Public Relations Von Finanzorganisationen - Amphetamin In Der Klinischen Medizin - Elektrische Industriefen Weiterverarbeitung - Sicher Auftreten Im Technischen Vertrieb - Lean-reporting - Prominenz - Ethnischer Radikalismus - Aus Der Praxis Der Kinderchirurgie - Peter Weiss Jahrbuch 7 - Lnger Erwerbsttig Aber Wie - Current Issues Of Suicidology - Bevlkerungsentwicklung Rentenfinanzierung Und Einkommensverteilung - Den Kundennutzen Managen - Terminhandel - Einzelkosten- Und Deckungsbeitragsrechnung - Telematik Im Strayenverkehr - The Pneumonias - Ingenieurmechanik 2 - Druck Und Stress Im Vertrieb Positiv Nutzen - Umweltorientierte Lebenszyklusrechnung - Grundzge Der Wissenschaftlichen Elektrochemie Auf Experimenteller Basis - Gerechtigkeitserleben Im Wiedervereinigten Deutschland - Die Stille Transformation - Nation Und Modernitt Als Mythen - Globalisierung Der Medien - Das Modell Deutschland Auf Dem Prfstand - Markt-management - Das Cold Spring Harbor Laborhandbuch Einsteiger - Telefonstichproben In Deutschland - Unix Systemverwalter - Aktie Im Aufwind - Preismanagement Im Privatkundengeschft Von Banken - Sicherheit Durch Gemeinschaft - Eingebettete Systeme - Kapitalmaynahmen - Weltanschauliche Erziehung In Der Ddr - Useful Plants Of Neotropical Origin - Anwendung Geophysikalischer Methoden In Der Hydrogeologie - Benachteiligte Jugendliche In Europa - Soziologie Im Konzert Der Wissenschaften - Finite Element Methods For Nonlinear Problems - Hyperbolic Partial Differential Equations - Finanzierung Und Investitionen Im Gesundheitsbetrieb - Erfolgsfaktor Unternehmenskultur - Anomalien In Handlungs- Und Entscheidungstheorien - Die Zuckerkrankheit Und Ihre Behandlung - Interkulturelle Kompetenz In Der Verwaltung - Die Reform Des Hheren Schulwesens Auf Grund Der Ostendorfschen These Der Fremdsprachliche Unterricht Ist Mit Dem Franzsischen Zu Beginnen - Interne Revision - Die Massenmedien Im Wahlkampf - Analysis Of Dynamic Psychological Systems - Lehren Lernen Und Fachdidaktik - Hacker Cracker Datenruber - Das Problem Der Industriearbeit - Die Wurzeln Der Westdeutschen Nachkriegsdemokratie - Atrioventricular Conduction In Congenital Heart Disease - Families Schools And Delinquency Prevention - Leitfaden Den Waldbau - Krisenmanagement Bei Strfllen - Aids And Obstetrics And Gynaecology - 3 Kongrey Der Deutschen Gesellschaft Intraokularlinsen Implantation - Computerized Cardiopulmonary Exercise Testing - Wagnisse Der Anpassung Im Arbeitsalltag - Myelin - Ironie In Der Alltagssprache - Arzt Und Private Krankenversicherung - Rechtsgrundlagen Des Architekten Und Ingenieurs - Die Entstehung Der Internationalen Maye Der Elektrotechnik - Optik Des Menschlichen Auges - Elemente Des Werkzeugmaschinenbaues - Steuerung Versus Emergenz Entwicklung Und Wachstum Von Unternehmen - Die Narkose - Leitfaden Der Histologie Des Menschen - Bilanzierung Nach Hgb Us-gaap Und Ias Im Vergleich - Rahmentragwerke Und Durchlauftrger - Comparative Embryology Of Angiosperms Vol 12 - Allgemeine Und Physiologische Chemie Der Fette Chemiker Mediziner Und Industrielle - –kologische Krise Und Marktmechanismen - „pleite Glotzt Euch An Restlos - Minimalinvasive Techniken In Der Gefy- Und Herzchirurgie - Niklas Luhmann Beobachtet - Axial- Und Radialkompressoren - Economic Theory Of Fuzzy Equilibria - Phase Separation In Cuprate Superconductors - Die Elektrostahlfen - Ablaufplanung In Der Halbleiter- Und Elektronikproduktion - Hazards To Drinking Water Supplies - Pro C 50 And The Net 45 Framework - Pflege Alter Menschen Als Beruf - Aktuelle Aspekte Medienpdagogischer Forschung - Synoptische Meteorologie - Cytomechanics - Leitfaden Zur Eisenhttenkunde - Edelguss - Entwicklungs- Und Bewegungsphysiologie Der Pflanze - Die Influenzapsychosen Und Die Anlage Zu Infektionspsychosen - The Fallopian Tube - Turbo Pascal Version 60 - Elemente Der Dritten Gruppe - Landesparlamentarismus - Elitenvertrauen Und Demokratie - Viruses Of Lower Vertebrates - Verrechnungspreise Zwischenprodukte - Jugendbilder - Advances In Ct Iv - Die Wertminderungen An Betriebsanlagen - Eine Frau Und Die Mathematik 19331940 - Grundriss Der Rntgentherapie - Information Theory And Best Practices In The It Industry - Direkte Demokratie In Den Deutschen Lndern - Mathematik Wirtschaftswissenschaftler - Sozialisation In Den 90er Jahren - Die Frage Der Verstaatlichung Der Kaliindustrie - Die Politischen Systeme Tschechiens Und Der Slowakei - Principles Of Abrasive Water Jet Machining - Alkaline Rocks And Carbonatites Of The World - Unternehmensbewertung Und Potentialanalyse - Rationelle Diagnostik Und Therapie Bei Koronarer Herzerkrankung - Governance Von Schul- Und Elementarbildung - Energietaschenbuch - Nichtlineare Optimierung - Glaucoma Update Iv - Eindrcke Aus Der Eisenindustrie Der Vereinigten Staaten Von Nordamerika - Digital Teleretinal Screening - Bildung Arbeit Erwachsenwerden - Geschichte Der Csu - Surfactant Replacement Therapy - 50 Jahre Empirische Wahlforschung In Deutschland - –ffentliche Verwaltung In Deutschland - Digitalisfibel Den Arzt - Psychopharmaka Im Widerstreit - Einhrung In Die Kryptologie - Size Exclusion Chromatography - Die Wirklichkeit Des Rechts - Politische Theorie In Den Usa - Von Der Erkenntniskritik Zur Kritischen Theorie Der Gesellschaft - New Advances In Computer Graphics - Methoden Der Ganzzahligen Optimierung - Fuzzy Methoden In Der Wirtschaftsmathematik - Der Kampf Des Ingenieurs Gegen Erde Und Wasser Im Grundbau - Der Tierarzt Im Hause - Erziehen Als Profession - Krieg Als Medienereignis - Entgrenzte Rume - Dienstvermittlung In Verteilten Systemen - Beobachtung In Der Schule Beobachten Lernen - Oxidative Injury In Dermatopathology - Der Fabrikbetrieb - Der Einfluss Der Medien - A Course In Mathematical Physics - Chemical Structures 2 - Grenzen Und Grenzberschreitungen Der Liebe - Zielgruppe Kind Kindliche Lebenswelt Und Werbeinszenierungen - Biochemisches Taschenbuch - Aktuelle Neuropdiatrie 1991 - Die Taxation Der Privat- Und Gemeinde-forsten Nach Dem Flchen-fachwerk - Dampferzeugung Dampfkessel Feuerungen - Das Erfolgreiche Einstellungs-interview - Die Strategische Ohn- Macht Der Friedensbewegung - Advances In Corrosion Science And Technology - Spiel Ohne Grenzen - Hilfsbuch Metalltechniker - Adaptive Wavelet-analysis - Atlas Anatomischer Varianten Des Schdels Im Rntgenbild - Mathematik Wirtschaftsingenieure Und Naturwissenschaftlich-technische Studiengnge - Benzodiazepines Ii - Anleitungen Zum Arbeiten Im Rhrenlaboratorium - Pathologie Des Trauma - Das Nordpolargebiet - Allergische Diathese Und Allergische Erkrankungen - Solarzellen - Milk Proteins - Deutschlandpolitik In Der Ffentlichen Meinung - Social Media Balanced Scorecard - Die Ausbildung Des Mediziners - Methods Theories And Empirical Applications In The Social Sciences - Pflegebedrftigkeit Und Pflegesicherung In Ausgewhlten Lndern - Das Regierungssystem Der Bundesrepublik Deutschland - Einhrung In Die Historisch-vergleichende Soziologie Max Webers - Advanced Course On Fairshape - Die Moderne Groystadt - Die Berechnung Von Gleich- Und Wechselstromsystemen - Abwasserhydraulik - Die Kunst Des Clusterns - Internationales Handbuch Der Gewaltforschung - Genetic Constraints On Adaptive Evolution - Chemiefasern Nach Dem Viskoseverfahren - Kreisprozesse Der Gasturbinen Und Die Versuche Zu Ihrer Verwirklichung - Bedienung Und Schaltung Von Dynamos Und Motoren Sowie Kleine Anlagen Ohne Und Mit Akkumulatoren - Abc Des Molkereilaboratoriums - Stoffwechsel Der Landwirtschaftlichen Nutztiere - Die Fragmentierung Des Medienpublikums - Kindheitsforschung Und Kommunale Praxis - Die Gewinnung Von Erdl Mit Besonderer Bercksichtigung Der Bergmnnischen Gewinnung - Anatomie Der Hrrinde - Suburbanisierung In Deutschland - Browirtschaft - Wie Weit Ist Der Weg Nach Deutschland - Beitrge Zur Entwicklungsgeschichte Der Kraniozerebralen Topographie Des Menschen - Operationslehre Der Endoskopischen Chirurgie - Kapital Und Kompetenz - New Concepts In Viral Heart Disease - Biology Of Antarctic Fish - Die Medicinischen Verbandmaterialien Mit Besonderer Bercksichtigung Ihrer Gewinnung Fabrikation Untersuchung Und Werthbestimmung Sowie Ihrer Aufbewahrung Und Verpackung - Spannungsoptik - Aids Leitlinien Die Praxis - Werkstoffkunde Die Elektrotechnik - Software-as-a-service - Zwei Drfer In Deutschland - Moden Als Zeitindikator - Die Pharmaindustrie - Normative Aspekte Der Public Relations - Nondestructive Evaluation Of Materials By Infrared Thermography - X-ray And Neutron Diffraction In Nonideal Crystals - Lumbar Spine Syndromes - The Collagens Biochemistry And Pathophysiology - Palozoologie - Das Glaukom - Marke Mit System - Handwrterbuch Internationale Politik - Stochastik - Praktische Bauphysik - Fundamentals Of Continuum Mechanics Of Soils - Molecular Genetics Biochemistry And Clinical Aspects Of Inherited Disorders Of Purine And Pyrimidine Metabolism - Grundlagen Des Ingenieurholzbaus - Macht Und Herrschaft - Wege Aus Der Ausbildungskrise - Achtzehnjhrige Zwischen Reaktion Und Rebellion - Umweltberichterstattung Im Lokalen - Soziales Im Netz - Handbuch Nachhaltige Entwicklung - Der Bildungspolitische Einigungsprozess 1990 - Aus Dem Bernerland - Der Umbau Des Sozialstaates - Niedersachsen-lexikon - Mit Sicherheit Gesund Bauen - Welfare Economics And Social Choice Theory - Werte Und Kriminalitt - Bndnis Arbeit - Handbuch Des Deutschen Theater- Film- Musik- Und Artistenrechts - Rechtsstaat Und Demokratie - Symmetries In Physics - Managerherrschaft In Deutschland - Cardiac Adaptation In Heart Failure - Unternehmerischer Wandel - Genetic Approaches To Coronary Heart Disease And Hypertension - Organisation Formen Und Modelle - Aachener Bausachverstndigentage 2005 - Geologisches Krftespiel Und Landformung - Rntgenphysik - Critical Perspectives On Neoliberal Globalization Development And Education In Africa And Asia - Systemdynamik Und Simulation - Wissen Managen Mit Innovativer Informationstechnologie - Morphology Of The Rocky Members Of The Solar System - Parametric Optimization Singularities Pathfollowing And Jumps - „mit Nfzehn Hat Es Noch Trume … - Cim-handbuch - Aufgabensammlung Mathematik Band 2 Analysis Mehrerer Reeller Variablen Vektoranalysis Gewhnliche Differentialgleichungen Integraltransformationen - Kartelle Gewerkschaften Und Genossenschaften - Ebene Und Rumliche Rahmentragwerke - Kompendium Event-organisation - Psychiatriereformen Zwischen Medikalisierung Und Gemeindeorientierung - Inference For Diffusion Processes - Sprache Des Deutschen Parlamentarismus - Funkkolleg Altern 1 - An Den Grenzen Der Psychiatrie - Systemtheorie Und Gender - Anker Und Ankerungen Zur Stabilisierung Des Gebirges - Konsumentenpsychologie Und Markenartikel - Immune Reactions - Tabubruch Als Programm - Qualitten Polizeilichen Handelns - Brokommunikation Von Der Planung Bis Zur Erfolgskontrolle - Sozialpolitik Und Sozialstaat - Stressbewltigungstraining Erwachsene Mit Adhs - Curriculum »politik« - Niederspannungs-leistungsschalter - Brgerschaft –ffentlichkeit Und Demokratie In Europa - Bemessungstafeln Eisenbetonkonstruktionen - Die Zukunft Kommunaler Betriebe - Body Experience - Management-trainings - Prfung Und Verarbeitung Von Arzneidrogen - Dimensions Of Food - Mediendiskursanalyse - Chemie Biologen - Symptomorientierte Diagnostik Bei Aphasien - The Design Of A Microprocessor - –konomie Und Mathematik - Computernetze Frauenpltze - Dynamics Of Science-based Innovation - Gewerkschaften Im Umbau Des Sozialstaats - Imagewirkungen Von Eventmarketing - Ist Die Erlebnisgesellschaft In Chemnitz Angekommen - Verhrtete Fronten - Betriebswirtschaftliche Fallstudien - Von Der Kundenorientierung Zum Supply Management - Mandantenorientierte Sachbearbeitung - Umweltbetriebsprfung Und –ko-auditing - Bezugsgruppenwechsel Und Bildungsaufstieg - Projektmanagement Als Organisationales Lernen - Soziale Arbeit Und Medien - Hochrisikoschwangerschaft - Grundkurs Java-technologien - Krper Sport Und Religion - Die Quarzlampe - Innere Medizin - „rzte Briefe Aus Vier Jahrhunderten - Lebensstil Und Mortalitt - Steps To Compliance With International Labour Standards - Zuwanderungspolitik Im Nationalstaat - Manual Of Pelvic Surgery - Verstndigungsprobleme Und Gestrte Kommunikation - Wissenstransfer Deutscher Universitten - Das Integrationspotential Des Internet Migranten - Cerebral Ischemia - Die Kurzmeldung - Geldanlage Mit Optionsscheinen - Epidemiology Of Prostate Disease - Schreiben Ohne Text - Advanced Combustion Science - Der Betriebs-chemiker - Soziales Handeln Und Strukturelle Selektion - Atlas Of Muscle Innervation Zones - Korruption Risikofaktor Mensch - Grundlagen Der Orthopdischen Mechanik - Ausschreibungshilfe Rohbau - An Introduction To Teichmller Spaces - Das Chaos Managen - Frankreich-jahrbuch 1988 - Ion Implantation In Semiconductors - Die Dreielektrodenrhre Und Ihre Anwendung - Rechnen In Der Verfahrenstechnik Und Chemischen Reaktionstechnik - Pressefreiheit Unter Druck - Tron Project 1990 - Helicobacter Pylori 1990 - Kollektive Identitt In Krisen - Gatt Und Neue Welthandelsordnung - Die Drehzahl-normung Und Ihre Wirtschaftliche Auswirkung Im Drehbankbau - Export Consortia In Developing Countries - Rassismus Wider Willen - Demokratie Und Judenbild - Die Trken Die Deutschen Und Europa - Cea Computergesttzte Erfahrungsgeleitete Arbeit - Leybold Vakuum-taschenbuch - Integrative Biological Psychiatry - Metallfachrechnen 5 - Die Grundlagen Den Vergleich Von Wrmeschutzangeboten - Bees As Superorganisms - Familie Arbeit Kinderbetreuung - Der Gesetzgeber Und Die Gentechnik - Optimierung - Mikrokologische Prozesse Im System Pflanze-boden - Wrmebertragung Im Gegenstrom Gleichstrom Und Kreuzstrom - Die Reklame Des Maschinenbaues - Medizinmanagement - „als Der Geist Der Gemeinschaft Eine Sprache Fand - Management Of Oesophageal Carcinoma - Verhandlungsdemokratie - Koordinaten-geometrie - Design For Environment As A Tool For The Development Of A Sustainable Supply Chain - Kombinierte Geverbindungen - Grundriy Der Ernhrungslehre - Der Strategie-scout - Die Religion Des Geldes - Zehnkampf-power Manager - Der Hrer In Die Flechtenkunde - Recht Bankfachwirte - Theorie Ideal Plastischer Krper - Private Schulen In Deutschland - Neuere Anschauungen Der Organischen Chemie - Der Wirtschaftliche Charakter Der Technischen Arbeit - Morphometry Of The Human Lung - Antarctic Ecosystems - Surgery Of The Deep Femoral Artery - Singles - Grundlagen Den Entwurf Von Braunkohlenbrikettfabriken Und Mglichkeiten Zur Verbesserung Ihrer Energieerzeugung Wrmewirtschaft Und Leistungsfhigkeit - Atmung Aufnahme Und Abgabe Gasfrmiger Stoffe - Journalistisches Handeln - Management Skills - Armut Und Soziale Integration - Organisationen Regeln - Programmierung Und Bearbeitung Groyer Informationsmengen - Reverse Engineering - Z-transformation Ingenieure - Prospects And Risks Beyond Eu Enlargement - Die Macht Des Kunden Und Wie Sie Ihn Trotzdem Kriegen - Differenz Und Integration Die Zukunft Moderner Gesellschaften - Nachhaltiges Lernen In Der Politischen Bildung - Islam Ist Nicht Gleich Islam - Die Kondensation Bei Dampfkraftmaschinen - Geldanlage Gewinner Trotz Krise Profitieren - Instandhaltung - Die Gesellschaftliche „natur Der Technik - Geschichtsunterricht Im Demokratischen Staat - New Trends In Management Of Cerebro-vascular Malformations - 40 Jahre Hessische Verfassung 40 Jahre Politik In Hessen - Fortschritte Der Teerfarbenfabrikation Und Verwandter Industriezweige - Bildung Im Cyberspace - Praktische Doppler-sonographie - Arbeitswissenschaft Im Nationalsozialismus - Stdtischer Raum Und Verhalten - Marken Und Sport - Inorganic Nitrogen In Plants And Microorganisms - The Physics Of Optical Recording - Polizeipolitik In Europa - Gewerkschaften Ohne Vollbeschftigung - Lonely Children And Adolescents - Biographien In Deutschland - Das Unternehmertum Und Die Ffentlichen Zustnde In Deutschland - Pdiatrie - Gabler Wirtschaftswrterbuch Russisch - Sozialstruktur Und Milieuerfahrungen - Elektro-fachkunde - Umweltdermatosen - Blutkrperchensenkung - Bausteinbasierte Software - Erzhlen Im Kontext Neuer Lernkulturen - 25 Jahre Kaiser Wilhelm = Gesellschaft Zur Frderung Der Wissenschaften - Analytische Und Numerische Methoden Der Feldberechnung - Raumbezogene Qualitative Sozialforschung - Gabler Lexikon Werbung - Personalauswahl Im Vertrieb - Psychologie Der Lebensalter - Integratives Mand A-management - Percutaneous Transluminal Angioscopy - Candida Albicans - Die Politischen Systeme Sdostasiens - Tauchen Mit Mischgas - Freie Mitarbeit In Den Medien - Das Altern Und Seine Beschwerden - Die Dreiteilige Groystadt Als Heimat - Biologie Im œberblick - Anleitung Zur Beurteilung Und Bewertung Der Wichtigsten Neueren Arzneimittel - Geldanlage Mit Optionen Und Futures - Dft - Diskrete Fourier-transformation - Lebensverlufe In Der Moderne 1 Nichteheliche Lebensgemeinschaften - Jugendarbeit In Groystdten - Reflectance Spectroscopy - Japans Neue Immigrationspolitik - Psychopharmacogenetics - Weddell Sea Ecology - Die Arbeitsweise Des Gehirns Und Die Psychischen Vorgnge - Microsoft Publisher Einsteigen Leichtgemacht - Kunden Auf Dauer Binden - Vob-musterbriefe Auftragnehmer - Das Gedchtnis Des Rundfunks - Event-based Programming - Ada - Die Mission Des Mzens - Methoden Der Digitalen Bildsignalverarbeitung - Psychotherapie In Zeiten Der Vernderung - Die Homerische Tierwelt - Wind Energy 19751985 - Neutron Physics - Ultraschalldiagnostik 88 - Die Eigenschaften Des Betons - Die Chemische Untersuchung Des Eisens - Wer Heiratet Wen - Die Praktische Werkstoffabnahme In Der Metallindustrie - Kommentar Zur Schiedsgerichtsordnung Das Bauwesen - Hydrologie - Keine Hochschule Den Sozialismus - Atlas Of Bone Scintigraphy In The Developing Paediatric Skeleton - Unternehmerische Versicherungswirtschaft - Weiterbildung In Kreditinstituten - Hren Lernen - Friedrich List Deutschlands Grosser Volkswirth - Politische Steuerung Im Wandel Der Einfluss Von Ideen Und Problemstrukturen - „der Rckblick Auf Die Vergangenheit Wird Sich Nicht Vermeiden Lassen - Der Aufbau Des Mrtels Und Des Betons - Texte Und Diskurse - Traumatologie Der Peripheren Nerven - Modellierung Der Welt - Advanced Android 4 Games - Einwanderung Im Spiegel Sozialwissenschaftlicher Forschung - Optical Information Processing - Speedmanagement Fusionen - Hhere Analysis Mit Derive - Allgemeine Diagnostik Und Therapie Der Hautkrankheiten - Die Zukunft Von Nationalstaaten In Der Europischen Integration - Elektro-fachzeichnen 1 - Mechanisms And Phylogeny Of Mineralization In Biological Systems - Madagaskar - Von Makis Und Menschen - Materials In Marine Technology - Analytische Und Prparative Labormethoden - Grundlegung Eines Verbandssteuerrechts - Biochemical Engineering For 2001 - Annherung An Die Volkspartei - Beyond Elder Law - Behavioral Branding - Intelligent Software Agents - Photodegradation Of Polymers - Grundlagen Der Erforschenden Statistik - A Manual Of Morphometry In Diagnostic Pathology - Rationalisierung Disziplinierung Und Differenzierung - Pflanzliche Stoffaufnahme Und Mikrobielle Wechselwirkungen In Der Rhizosphre - Applied Control Of Manipulation Robots - Entomology - The Global Race For Foreign Direct Investment - Volume 1 Mechanisms Of Inorganic And Organometallic Reactions - Costs And Benefits In Health Care And Prevention - Bausteine Des Chaos Fraktale - Chirurgische Intensivmedizin - Childhood Tuberculosis Modern Imaging And Clinical Concepts - Kritisches Forschen In Der Sozialen Arbeit - Elementarmathematik Griffbereit - Autocad Grundkurs - Gestaltung Des Sozialen Eine Herausforderung Europa - Mobilfunknetze - Das Management Von Stoffstrmen - Beitrag Zur Frage Der Zeitermittlung Und Zur Planmyig-wissenschaftlichen Arbeitszuweisung Bzw Gruppenzusammensetzung Bei Reinen Handarbeiten Auf Grund Arbeitswissenschaftlicher Untersuchungen Besonders An Schlosserarbeiten - Wirksamkeit Deutscher Berufsbildungszusammenarbeit - Lindenstraye - Pathologische Histologie - Infant Feeding - Der Erdwachsbergbau In BorysÅ‚aw - Technische Schwingungslehre In Ihren Grundzgen - Metallfachrechnen 5 Heizungs- Und Raumlufttechnik - Vermarktung Des Spitzenhandballs - Access To B-isdn Via Pons - Die Selbstttige Regelung Elektrischer Maschinen - Preismanagement - Chemie Der Heterocyclen - The Evolution Of The Use Of Mathematics In Cancer Research - Bildung Als Bedrohung - Die Pathogenen Protozoen Und Die Durch Sie Verursachten Krankheiten - Value Reporting - Kinderlosigkeit In Deutschland - Hre Dich Selbst - Survival-guide Chirurgie - Technological Change In A Spatial Context - Mr Imaging Of The Skull And Brain - Motor Neuron Disease - Mehr Umsatz Mit Kaltakquise Und Direktbesuch - Handbuch Der Normalen Und Pathologischen Physiologie - Stdtische Armutsquartiere - Kriminelle Lebenswelten - New Methods Of Thought And Procedure - Analysis In Dimension 1 - Wie Die Medien Die Welt Erschaffen Und Wie Die Menschen Darin Leben - Sozialstruktur Im Umbruch - Dauer Und Abbau Der Kriegswirtschaft - Prfungsvorbereitung Groy- Und Auyenhandelskaufleute - Humankologische Perspektiven In Der Gesundheitsfrderung - Transnationale Konzerne Im Weltsystem - Thermoregulation Of Sick And Low Birth Weight Neonates - Charakter Und Nervositt - The Taxation Of Capitalistic Bequests - Ebene Grundwasserstrmungen Mit Freier Oberflche - Kernpunkte Der Preisbildung Im Verkehrswesen - Mediengeschichte Und Kulturelle Differenzierung - Metallurgische Berechnungen - Grundlagen Zur Erforschung Des Alterns - Allgemeine Elektrotechnik - The Physiology Of The Compound Eyes Of Insects And Crustaceans - Qualitatives Forschen In Der Erziehungswissenschaft - Durchwurzelung Rhizodeposition Und Pflanzenvergbarkeit Von Nhrstoffen Und Schwermetallen - Gelegenheit Macht Diebe Doch Frauen Klauen Auch - Lehrbuch Der Gesamten Chemie - Grundriss Der Pathologischen Anatomie - Mensch Maschine Megabyte - Grundriss Der Pharmaceutischen Maassanalyse - Histology Of Ancient Human Bone Methods And Diagnosis - Gehltes Wissen Als Emotional-krperbezogene Ressource - Die Gleichstrom-dynamomaschine - Advances In Ct Iii - Tropical Forestry Handbook - Journalismus And Kompetenz - Alternative Weltordnungsmodelle - Audiovisuelle Fernkommunikation - Fachrechnen Elektroberufe - Evolutionr Hren - Digitale Kommunikationsnetze - Preismodelle Deutscher Banken Im Privatkundengeschft - Die Bestimmung Der Vaterschaft - Technologiemanagement And Marketing - Die Eiweisskrper Und Die Theorie Der Kolloidalen Erscheinungen - Haarkrankheiten Und Kosmetische Hautleiden - Das Surebestndige Email Und Seine Industrielle Anwendung Im Apparatebau - Der Coronarkreislauf - Beobachtung Verstehen Verstehen Beobachten - Handbuch Europischer Kapitalmarkt - Grundmuster Visueller Kultur - Micromounts - Joint Ventures Im Chinesischen Kulturkreis - Komplikationsmanagement Im Herzkatheterlabor - Basic-wegweiser Ibm Pc Pc Xt Portable Pc Und Pcjr - Intracranial Pressure Viii - Gynkologie Und Geburtshilfe 1988 - Die Hollndische Landwirtschaft - Im Westen Was Neues - Materialien Zur Erforschung Der Ddr-gesellschaft - Liniendiagramme In Der Wissenskommunikation - Jahrbuch Psychodrama Psychosoziale Praxis And Gesellschaftspolitik 1993 - Organisationsbezogenes Qualittsmanagement - Change Management In Der Sozialwirtschaft - Talentmanagement Mit System - Interaction Evolution And Chaos In Space - Irans Kampf Um Wasser - Restriktionen Politischer Steuerung Des Rundfunks - Rohrleitungs- Und Apparatebau - Stochastische Signale - Plant Viruses - Mg2+ And Excitable Membranes - Fabrikorganisation Fabrikbuchhrung Und Selbstkostenberechnung Der Ludw Loewe And Co A-g Berlin - Radikaler Antisemitismus - Briefe - Die Insulinshockbehandlung Der Schizophrenie - Statistische Methoden Der Netzplantechnik - Structural Neurochemistry - Die Organisation Der Riesenstadt - Spectral Synthesis - Migration Familie Und Soziale Lage - Algebra Und Zahlentheorie - Gynkologische Operationstechnik - Die Theorie Der Bodensenkungen In Kohlengebieten Mit Besonderer Bercksichtigung Der Eisenbahnsenkungen Des Ostrau-karwiner Steinkohlenrevieres - Medienpolitische Strategien Das Interaktive Fernsehen - Electronic Banking Im Vertrieb - Bildungsbericht Deutschland - Amerikanische Und Deutsche Groydampfkessel - Computational Mechanics 86 - Elektrisches Kochen - Die Elektromotoren In Ihrer Wirkungsweise Und Anwendung - Epidemiology And Management Of Root Diseases - Finite Element Analysis For Heat Transfer - Communicate Or Die - Deutsche Familiensoziologie - 11 Kongrey Der Deutschsprachigen Gesellschaft Intraokularlinsen-implantation Und Refraktive Chirurgie - Die Sozialen Arbeitsverhltnisse Im Wandel Der Zeit - E-mail-management - Cim Integration Und Vernetzung - œbungen Zur Technischen Strmungslehre - Multinationals In The New Europe And Global Trade - Intraoperative Neurophysiologic Monitoring In Neurosurgery - Arsenic And Rice - Der Apotheker Als Subjekt Und Objekt Der Literatur - Kritik Satire Parodie - Transportmanagement - Numerik Gewhnlicher Differentialgleichungen - Jedem Kind Sein Instrument - –ko-audits Nach Der Verordnung Der Eu - Acht Jugendportrts - Was Will Die Jngere Mit Der Lteren Generation - Das Politische Organisationsfeld - Applied Dynamics Of Manipulation Robots - Tuberkulose Im Kindesalter - Systematisches Arbeiten Mit Basic - Demokratie Nach Dem Ende Des Kommunismus - High-energy Aspects Of Solar Flares - Praxis Der Brustoperationen - Grundzge Einer Physiologie Und Klinik Der Psychophysischen Persnlichkeit - Grundversuche Der Physik In Historischer Darstellung - Heute Akquirieren - Sofort Profitieren - Knigin Luise - Kosmetik - Unternehmensfinanzierung - Das Kieselsuregel Und Die Bleicherden - Die Verhaltenstherapeutische Behandlung Des Stotterns - Gruppenarbeit - Sap Apo In Der Praxis - Defect And Fault Tolerance In Vlsi Systems - Leben In Armut - Flchentragwerke - Zwischen Anpassung Und Konfrontation - Friedensengel Im Kampfanzug - Die Groyen Regierungserklrungen Der Deutschen Bundeskanzler Von Adenauer Bis Schrder - Creativity For 21st Century Skills - Fifth Generation Computer Systems 1988 - Inszenierungen Von Weiblichkeit - Einhrung In Die Fuzzy-logik - Die Herstellung Und Verarbeitung Der Viskose Unter Besonderer Bercksichtigung Der Kunstseidenfabrikation - Marktberlegenheit Und Persnliche Effizienz - –kologisch Planen Und Bauen - Der Inoperable Krebskranke - Handbuch Kinder Und Husliche Gewalt - Digitalrechner Grundlagen Und Anwendungen - Der Euro-kapitalmarkt - Die Regelung Der Kraftmaschinen - Jenseits Des Rationalen Handelns - Rechtsextremismus Und Fremdenfeindlichkeit - Determinanten Der Markteintrittsreihenfolge Von Imitativen Internet Start-ups - Geheimnisse - Physiology Of Elasmobranch Fishes - Methods Of Protein And Nucleic Acid Research - Insect Conservation Past Present And Prospects - Die Grenzen Der Wirtschaftspolitik - Mglichkeiten Und Grenzen Der Antineoplastischen Therapie - Soziale Ungleichheit In Deutschland - Grundlagen Der Fabrikorganisation - Zur Organisation Des Grndungserfolgs - Einhrung In Die Lineare Algebra - Der Elastisch Drehbar Gesttzte Durchlaufbalken Durchlaufende Rahmen Gebrauchsfertige Zahlen Einfluylinien Und Grytwerte Der Momente - Vernetzte Wirtschaft Und Konomische Entwicklung - Aktuelle Therapie Des Prostatakarzinoms - Sozialisation Zur Mitbrgerlichkeit - Ermittlung Der Billigsten Betriebskraft Fabriken - Fluktuationen Und Dynamik Aktiver Halbleiter-bauelemente - Handbuch Der Thoraxchirurgie Encyclopedia Of Thoracic Surgery - Umwelt-bioverfahrenstechnik - Extra- Und Intrakranielle Farbduplexsonographie - Erfolgreiches It-management In Der Praxis - Anleitung Zu Den Physiologischen œbungen - Schlsselwerke Der Soziologie - Flucht Vor Dem Gewissen - Neuere Erfahrungen Ber Die Behandlung Und Beseitigung Der Gewerblichen Abwsser - Ministerielle Richtlinien Der Gesetzestechnik - Theoretical Physics - Kolben- Und Turbo-kompressoren - Pet And Petct Study Guide - Atomphysik - Lineare Algebra Und Analytische Geometrie Ii - Demokratie Auf Dem Prfstand - New Fluorinating Agents In Organic Synthesis - Umwelt Beschftigung Und Zukunft Der Wachstumsgesellschaften - Konflikte Im Betriebsrat Als Lernanlass - Der Professionelle Lehrer - Dictionary Of Global Climate Change - Die Planungszelle - Neue Lebensstile In Der Arbeiterschaft - Moralische Individualitt - Kulturrevolution - Prnatale Dopplerdiagnostik - Die Organisation Der Parteien In Russland - Erklrungsnotstand Altersvorsorge - Electrical Processes In Atmospheres - Organisationen Und Netzwerke Der Fall Gender - Perinatal Retinal Haemorrhages - Rhizosphrenprozesse Umweltstrey Und –kosystemstabilitt - Umweltschutz Und Staatsversagen - Hydrocarbons Of Eastern Central Europe - Adhesives Technology Compendium 2009 - Advances In Clinical Nutrition - Das Fassungsvermgen Von Rohrbrunnen Und Seine Bedeutung Die Grundwasserabsenkung Insbesondere Gryere Absenkungstiefen - Lehrbuch Der Funktionellen Diagnostik Und Therapie Der Erkrankungen Des Herzens Und Der Gefsse - Schwarze Lcher Im All - Dense Gases For Extraction And Refining - Von Der Naturforschung Zur Naturwissenschaft - Unternehmen Berlebensfhig Machen - Die Zeit Des Politischen Entscheidens - Organisation Des Rundfunks - Theorie Rationalen Handelns - Die Ffentliche Meinung In Der Auyenpolitik - Einhrung In Die Geophysik Ii - Mikrosystemtechnik - Plasmaphysik Und Fusionsforschung - Kfz-rechnen - Handbuch Offene Kinder- Und Jugendarbeit - Der Herzinfarkt - Introduction To Earth And Planetary System Science - Strategisches Controlling - Agil Macht Stabil - Perspektiven Der Germanistik - Sprechwissenschaft And Psycholinguistik - Maple V Language Reference Manual - Demokratietheorie Und Politische Institutionen - Methods Of The Classical Theory Of Elastodynamics - The Endothelium In Cardiovascular Disease - Kommunikationswissenschaft Als Integrationsdisziplin - Ergebnisse Der Exakten Naturwissenschaften - X-ray Microscopy And Spectromicroscopy - Proceedings Of The First Lunar International Laboratory Lil Symposium Research In Geosciences And Astronomy - Risiken Im Bauvertrag - Logistiknetzwerke - Beitrge Zur Angewandten Wirtschaftsforschung - Die Separation Von Feuerungsrckstnden Und Ihre Wirtschaftlichkeit - The International Monetary System - Pro Nuget - Distributed Systems - E-markets - Motive Und Weiterbildungsbedarf - Interregional Migration - Statistische Datenanalyse - Massenmedien Und Lokaler Protest - Hrer Durch Die Technische Mechanik - Using Technology To Sell - The Role Of Community-mindedness In The Self-regulation Of Drug Cultures - Science Education In International Contexts - Mathematik In Der Praxis - Handbuch Si-einheiten - European Monetary Integration - Die Klinik Der Tuberkulose Erwachsener - At1-rezeptorblockade - Pro Windows Phone App Development - Crm Den Mittelstand - Die Verwaltung Der Ffentlichen Arbeiten In Preuyen 1900 Bis 1910 - Soziale Distanz - Recent Advances In Coronary Circulation - Geology Of Holocene Barrier Island Systems - Immune Consequences Of Trauma Shock And Sepsis - Neueste Ergebnisse Ber Betamimetika - Technische Kompositionslehre - Gehirn Und Rckenmark - Grundriy Der Mineralparagenese - Wahrscheinlichkeitsrechnung Und Statistik In Beispielen Und Aufgaben - Controlling-management - Die Technik Des Khlschrankes - Die Regierungssysteme Der Deutschen Lnder - Solidaritt - Grundkurs Socketprogrammierung Mit C Unter Linux - Quantitative X-ray Diffractometry - Fremde · Freunde · Feindlichkeiten - Risk Analysis And Decision Processes - Die Soziologie Theodor Geigers - Operationsverstrker - Zeitgenssische Amerikanische Soziologie - Cad Bauingenieure - Lebenserinnerungen Eines Ingenieurs - Sozialkundestunden - 11 Irrtmer Ber Social Media - Iron Metabolism - Hans J Morgenthau Und Der Weltpolitische Realismus - Berechnung Des Eisenbetons Gegen Verdrehung Torsion Und Abscheren - Einhrung In Die Deutsche Literatur Des 12 Bis 16 Jahrhunderts - Anorganische Strukturchemie - Diagnostische Bewertung Von Laborbefunden - Umweltvertrglichkeit In Der Abfallwirtschaft - Die Seminarien Volksschullehrer - Technology-rating - Breast Diseases - Allgemeinerkrankungen Infolge Schlechter Zhne - Augenerkrankungen Im Kindesalter - Ernst Curtius - Massenkommunikation - Fraktale Geometrie Eine Einhrung - Der Praktische Fall - Die Grenzgnger - Geschftserfolge In Den Usa - Essential Psychology - Die Institutionenordnung Der Ddr - Streitgesprche - Abdominal Angiography - Histochemie - Der Verband Der Hochschullehrer Betriebswirtschaft - Tumours Of The Female Lower Genital Tract - Investment Confidence And Business Cycles - Globale Konflikte Oder Global Governance - A Guide To Addiction And Its Treatment - Projektmanagement Der Sw-entwicklung - Efficient Usage Of Adabas Replication - Dauermagnete - Echtzeitsysteme Und Objektorientierter Entwurf - Rentabel Durch Total Quality Management - Bildungsautonomie Zwischen Regulierung Und Eigenverantwortung - Ellbogenchirurgie In Der Praxis - Feldanalyse Als Forschungsprogramm 2 - Hausfamilien - Grundlagen Des Beton- Und Eisenbetonbaues - Economic And Financial Knowledge-based Processing - Einfluyfelder Orthogonal Anisotroper Platten Influence Surfaces Of Orthogonal Anisotropic Plates - The Right Heart - Die Telegraphentechnik - Wrterbuch Zur Politischen –konomie - Microcomputers In Medicine - Raumforderungen Der Niere Im Sonographischen Bild - Edi-knigge - Rechnungslegung Nach Neuem Recht - Vom Medienkind Zum Kinderstar - Bewusstseinsvorgang Und Gehirnprozess - Europas Tchter - Pathophysiology Of Shock Sepsis And Organ Failure - Surface Science - Datenverarbeitung Ingenieure - Nuclear Radiation In Geophysics Kernstrahlung In Der Geophysik - Medien Und Sthetische Kultur - Geschichte Des Landes Sachsen-anhalt - Demokratie Als Erfahrung - Lineare Algebra Und Analytische Geometrie - Umweltrisiko Und Raumentwicklung - E-shopping - Systemtheorie Und Neue Soziale Bewegungen - Qualitative Psychologie - Junge Ostdeutsche Auf Der Suche Nach Der Freiheit - Molecular Neurobiology Of The Mammalian Brain - Innen Beginnen - Staatenkooperation In Der Eu Und Darber Hinaus - Krise Und Zukunft Des Sozialstaates - Beginning Ios 5 Development - Das Waschen Mit Maschinen In Gewerblichen Wschereibetrieben In Hotels Krankenhusern Und Anderen Ffentlichen Und Privaten Anstalten - Integriertes „nderungsmanagement - Minderjhrige Flchtlinge - Kreative Industrien - Endokrine Und Stoffwechselkrankheiten - Die Lehre Von Den Kettenbrchen - Jahrbuch Medienpdagogik 1 - Infektise Endokarditis - Depressionskonzepte Heute Psychopathologie Oder Pathopsychologie - Participatory Governance In Multi-level Context - Pro Php Mvc - Talent-management Spezial - Handbuch Bildungsforschung - Der Kugeldruckversuch Nach Brinell Die Hrteprfung Mit Vorlast Und Die Hrteprfung Nach Vickers - Handbuch Der Physikalischen Maassbestimmungen - Demokratiemessung - The Political Economy Of Progressive Taxation - Handbuch Fahrerassistenzsysteme - Erfolg Ist Eine Reise - Zwischen Akteur Und System - œbungsbuch Ifrs - Der Kaspar-hauser-effekt - The Pathology Of The Endocrine Pancreas In Diabetes - Jugend Vor Der Moderne - Wie Beurteilt Man Eine Bilanz - Dictionary Of Food And Ingredients - Kriminaltaktik Mit Besonderer Bercksichtigung Der Kriminalpsychologie - Reaktivierungsmanagement Von Not Leidenden Unternehmen - Kochlehrbuch Und Praktisches Kochbuch - Schwarzes Geld And Weiye Weste - Erfolg Durch Innovation - Lehrbuch Der Inneren Medizin Schwestern - Informelles Lernen Im Sport - Grundlagen Der Pathologischen Anatomie Studierende Und „rzte - Interface Oral Health Science 2011 - Auf Der Suche Nach Thrill Und Geborgenheit - Rechnen Bankkaufleute - Wiederverwendung Qualitativer Daten - Die Einsamkeit Des Schreibers - Isse 2011 Securing Electronic Business Processes - Gewaltspiralen - Extrema Of Smooth Functions - Kosmische Strahlung - Learn Objective-c On The Mac - Grundlegende Algorithmen Mit Java - Organic Chemistry Of The Earth Atmosphere - Neuordnung Der Lehrerausbildung - Form Und Endziel Einer Allgemeinen Versorgung Mit Elektrizitt - Wechselmodell Psychologie Recht Praxis - Einwandererverbnde In Der Migrations- Und Integrationspolitik 1998-2006 - Das Russische Parlament - Psychophysiological Mechanisms Of Hypnosis - Soziale Zeit Und Biographie - Lsungen Mandantenorientierte Sachbearbeitung - Medienkultur Kulturkonflikt - Bewehren Nach Din En 1992-1-1 Ec2 - Der Knstliche Pneumothorax - Kompendium Der Frauenkrankheiten - Beginning Android 4 Games Development - Global Events And Event Stratigraphy In The Phanerozoic - Viral Hepatitis And Liver Disease - Cellular And Molecular Alterations In The Failing Human Heart - Ambivalenz - Programmierkurs Turbo-pascal Version 70 - Arƶnei Als Wert - Postsozialistische Religion - Theatralisierung Der Gesellschaft - Statistische Thermodynamik - Corporate-governance-management - Guicciardinis Kritik An Machiavelli - Infected Total Joint Arthroplasty - Scheduling In Computer And Manufacturing Systems - Die Zoologie Der Trume - Spss Windows - Epidemiology Of Cerebrovascular Disease - Computational Systems Neurobiology - Elektrische Reaktions-audiometrie - Die Heizerschule - Grundlagen Der Strahlungsphysik Und Des Strahlenschutzes - Das Devisentermingeschft In Seinen Beziehungen Zur Whrung Und Wirtschaft - Desintegrationsdynamiken - Europa Zwischen Ordnungswettbewerb Und Harmonisierung - Leib Krper Und Identitt - Militr Und Jugend Im Ns-staat - Schiefhals - Lehrbuch Der Nomographie - Die Synthese Von Einheitlichen Polymeren - Unternehmen Unix - Die Unmittelbare Kranken-untersuchung - Neurolinguistik - Pediatric Metabolic Syndrome - Auf Den Ersten Blick - Betriebs-handbuch Bhr 64 Pittler-revolverdrehbnke - Sinnwelt Freizeit - Kulturvergleichende Psychologie - Medien Und Fremdenfeindlichkeit - Menschenrechtsbildung - Das Zentralnervensystem Des Menschen - Talentmanagement Durch Trainee-programme - Elektrodynamik - Wissenskapitalisten Oder Sldner - Laparoscopy And Imaging Techniques - Klingelnberg-palloid-spiralkegelrder - Grundzge Der Bergbaukunde Einschliesslich Aufbereitung Und Brikettieren - Wirksame Und Unwirksame Klauseln Im Vob-vertrag - Staat Und Politische Bildung - Verkaufsgesprche Und Verkaufstrainings - Arbeitsmarkt Und Wettbewerb - Muslimische Patienten Pflegen - Handbook Of Recording Engineering - Lohas-marketing - Die Herstellung Der Feuerfesten Baustoffe - Einhrung In Die Rechtssoziologie - Bibliographie Der Gesamten Gynaekologie Und Geburtshilfe Sowie Deren Grenzgebiete Das Jahr 1913 - Buchhrung Und Bilanz - Deutsche Europapolitik Von Konrad Adenauer Bis Gerhard Schrder - Analysis And Simulation Of Semiconductor Devices - Gesellschaftsbilder Im Umbruch - Der Einstieg Ins –ko-audit Mittelstndische Betriebe - Die Lagersttten Nutzbarer Mineralien - Bacillus Thuringiensis Biotechnology - Kinderrepubliken - Bildung In Frankreich - Macromolecular Complexes In Chemistry And Biology - Das Billionen-dollar-unternehmen - Spannbetontrger - Terminal Ballistics - Die Politik In Der Kunst Und Die Kunst In Der Politik - Air-surface Exchange Of Gases And Particles 2000 - Der Islam - Der Fernsprechverkehr Als Massenerscheinung Mit Starken Schwankungen - Aufgabensammlung Elektrotechnik 1 - Fernsehwerbung Quo Vadis - Relationships Between Perception And Action - Lnderbericht Frankreich - Die Berechnung Von Kreisfrmig Begrenzten Pilzdecken Bei Zentralsymmetrischer Belastung - Nationalstaaten In Der Eu Identitt Und Handlungsmglichkeiten - The Interferon System - Diseases Of The Human Carotid Body - Werkstckspanner - Lehrmeister Whrungskrise! - Principles Of Bone Regeneration - Nahost Jahrbuch 1999 - Ein Lehrbuch Der Botanik - Die Neueren Arzneimittel - Hrungsfrderndes Human Ressource Management - Symbolische Politik Der Vereinten Nationen - Zur Rolle Des Vorwissens Beim Verstehen Literarischer Texte - Der Verkehrswasserbau - Bericht Ber Die 4 Sachverstndigen-konferenz Des Deutschen Vereins Zur Sorge Jugendliche Psychopathen Ev - Das Bayernwerk Und Seine Kraftquellen - Die Behandlung Der Haut- Und Geschlechtskrankheiten In Der Sprechstunde - Zahlungsverhalten Am Stationren Point Of Sale - Active Oxygen In Biochemistry - Das Werk Heinrich Blls - „sthetische Kommunikation Der Moderne - Zivile Gesellschaft - Methoden Der Textanalyse - Kriegsdiskurse - Principles Of Fluorescence Spectroscopy - Intelligent Transportation And Evacuation Planning - Versuchungen - Grundbau - Recent Developments In Particle And Field Theory - Die Stadt Der Zukunft - Hydrogeologische Untersuchungsmethoden Von Altlasten - Wohlfahrtsstaatliche Politik - Die Satzrdersysteme Der Evolventenverzahnung - Technology Cad Systems - Schienenverkehrstechnik - Wege Aus Der Krise - Microsurgery Of The Temporo-medial Region - Allgemeine Physikalische Und Klinische Untersuchungen - Erzieherinnen In Beruf Und Freizeit - Der Contrapunkt - Soziologische Abenteuer - Ultraschallfibel Gynkologie Und Geburtshilfe - Orthopdisch-chirurgische Operationslehre - Theory Of Mind - Forum Qualitative Schulforschung 2 - Medienkompetenz - Die Theorie Sozialer Schlieyung - Kurze œbersichtstabelle Zur Geschichte Der Medizin - Lehrbuch Der Entwicklungsgeschichte Des Menschen - Arduino And Kinect Projects - Sitzhaltung · Sitzschaden Sitzmbel - Vergleichende Regierungslehre - Mri Of The Body - Biogene Arzneistoffe - Bildgebende Diagnostik Bei Lebererkrankungen - Jugend In Arbeit - Quo Vadis Ct - Coronary Circulation In Physiological And Pathophysiological States - Physikalische Medizin Balneotherapie Und Rehabilitation Im Hheren Lebensalter - Junge Technologieunternehmen - Einhrung In Die Hhere Mathematik - Der Weg In Die Neteconomy - Die Prognose Chronischer Erkrankungen Long-term Observations Of Chronic Diseases - Qualitative Chemische Analyse - Buchhrung Der Kreditinstitute - Thonner Analytical Key To The Families Of Flowering Plants - Soziale Netze Und Soziale Untersttzung Alleinerziehender Frauen - Die Liberale Nation - Komprimiertes Kennzahlen-know-how - Arztrecht - Information Technology For Small Business - Ethnizitt Und Raum Im Aufstiegsprozey - Sozialkologie - C Net Mit Methode - Marketing Intelligence - Die Chemie Der Trocknenden –le - Hochhuser In Deutschland - Altersbilder In Der Wirtschaft Im Gesundheitswesen Und In Der Pflegerischen Versorgung - Die Leberkrankheiten - Rollenkonfigurationen Rollenfunktionen Und Gesundheit - Magnetogasdynamics And Plasma Dynamics - Prolegomena Einer Medizinischen Anthropologie - Chromosomal Aberrations - Selektivschutz - Ein Haus Ein Aufruhr - Grundriss Der Gesundheitssorge - Profikurs Php-nuke - Die Ernhrung Gesunder Und Kranker Kinder „rzte Und Studierende Der Medizin - Essays In The History Of Mechanics - Beginning Sql Server 2012 Administration - Prvention Von Jugendgewalt - Grundzge Der Pathologischen Physiologie - Repetitorium Zur Kosten- Und Leistungsrechnung - Continuum Theory Of Inhomogeneities In Simple Bodies - Aufstze Zur Deutschen Revolution - Rotation Divergenz Und Gradient - Sozialwissenschaftliche Datenanalyse - Stromrichter-netzrckwirkungen Und Ihre Beherrschung - Das Frben Und Bleichen Der Textilfasern In Apparaten - Hygiene Und Ditetik Der Frau - Sozialdemokratische Reformdiskurse - Die Angewandte Zoologie - Die Reichsfinanzgesetzgebung Von 1913 - Stereotactic Techniques In Clinical Neurosurgery - Cranial Meningiomas - Die Wirtschaftlichkeit Als Konstruktionsprinzip Im Eisenbetonbau - Handbuch Der Chemisch-technischen Apparate Maschinellen Hilfsmittel Und Werkstoffe - Acronyms And Abbreviations In Molecular Spectroscopy - Institutional Partnerships In Multi-hazard Early Warning Systems - Metabolic Turnover In The Nervous System - Konservative Therapie In Schwangerschaft Geburt Und Wochenbett - Knftige Lebenswege Von Schulkindern - Recovery From Brain Damage - Geschichte Der Politischen Ideen - Klinische Rntgendiagnostik Des Verdauungskanals - Quantitative Genetik - Corporate Religion - Wirtschaftsprfung - Berechnung Von Rahmenkonstruktionen Und Statisch Unbestimmten Systemen Des Eisen- Und Eisenbetonbaues - Peter Weiss - Die Satisfaction-profit Chain In Der Logistikdienstleistungsbranche - Die Wanderwellenvorgnge Auf Experimenteller Grundlage - Vom Fachexperten Zum Wissensunternehmer - Diagnostic Imaging Of The Nose And Paranasal Sinuses - Einhrung In Die Halbleitertechnologie - Die Behandlung Und Verhtung Der Rachitis Und Tetanie - Handbook Of Technical Diagnostics - Schenken - Software-engineering - State-of-the-art In Computer Animation - Parteien Und Whler Im Umbruch - Die „rztliche Beurteilung Beschdigter - Die Frau - Cohomology Theories For Compact Abelian Groups - Adapted Physical Activity - Niedrigdosisstrahlung Und Gesundheit - Heat Shock - Die Ethnisierung Von Alltagskonflikten - Skriptum Informatik - Kulturwissenschaftliche Hermeneutik - Handlung Und Kompetenz - Netzhautabhebung - Die Fichte In Bezug Auf Ertrag Zuwachs Und Form - Carl Schmitt Und Die Liberalismuskritik - Psychologie Als Gesellschaftswissenschaft - Erzhlungen Im –ffentlichen - Logistikprozesse Mit Sap R3 - Randelementmethoden - Das Prostatakarzinom - Externe Berater Erfolgreich Einsetzen - Afrika Jahrbuch 2000 - Der Semidnnschnitt - Grundlagen Qualittsmanagement - Geschichte Der Segelschiffe - Low Temperature Detectors For Neutrinos And Dark Matter - Umweltgerechter Verkehr - „sie Wollen Mir Doch Was Verkaufen! - Demographische Analyse Und Populationsdynamische Modelle - Bankenaufsicht - Practical Android 4 Games Development - Wohlfahrtsstaat Einwanderung Und Ethnische Minderheiten - An Den Rndern Der Deutschen Hauptstadt - Tourismus Im Lndlichen Raum - Lautlos Hren - Zwischen Lust Und Frust Jugendsexualitt In Den 90er Jahren - Ozon - Mathematik Bauingenieure - Organisationsvielfalt Und Betriebliche Gesundheitsfrderung - Wenn Aus Liebe Rote Zahlen Werden - Leistungsgerechte Vergtung Verkaufsteams - Beschftigungschancen Und Betriebszugehrigkeit - Hegels Philosophie Des Subjektiven Geistes Hegel Philosophy Of Subjective Spirit - Schrder Gegen Stoiber - Auyenwirtschaftslehre - Feministische Kommunikations- Und Medienwissenschaft - Der Nahrungsbedarf Des Menschen - Sexuelle Gewalt Gegen Behinderte Menschen Und Das Recht - Physiologie Und Pathophysiologie Der Atmung - Parteienfinanzierung - Ellenberger-schtz Jahresbericht Ber Die Leistungen Auf Dem Gebiete Der Veterinr-medizin - Diagnose Und Therapie Der Gonorrhoischen Erkrankungen In Der Allgemeinpraxis - Systematisches Projektieren Und Konstruieren - Freie Durchforstung - Enzyme Handbook 4 - Die Organischen Wurƶeln Der Lautsprache Des Menschen - Industrielle Enzyme - Der Staat Der Autonomen Gemeinschaften In Spanien - Die Private Vermgensanlage Des Unternehmers - Deutsche Philosophie - Konferenzen Professionell Organisieren - The Biokinetics Of Flying And Swimming - Handbuch Technische Oberflchen - Die „tiologie Der Bsartigen Geschwlste - Menschenrechte Und Europische Auyenpolitik - Mechanische Technologie Der Metalle - Autocad Praktikum - Technikentwicklung Und Politische Bildung - Structural Safety Evaluation Based On System Identification Approaches - Magnetic Resonance In Nephrourology - Allgemeine Pathologie - Kinematisch-getriebeanalytisches Praktikum - Der Einkauf Als Margenmotor - Stahlbetonbau Nach Ec 2 - Der Durchlaufende Bogentrger Auf Elastischen Sttzen Mit Und Ohne Versteifungstrger - Berufswahl Und Bewhrung - Geschlechterdifferenzierungen Im Horizont Der Gleichheit - Proceedings Of The Twelfth International Conference On The Physics Of Semiconductors - Klinische Rntgendiagnostik Der Erkrankungen Der Brustorgane - Ct And Mri Of Disk Herniations - Der Durchfluy Des Wassers Durch Rhren Und Grben Insbesondere Durch Werkgrben Groyer Abmessungen - Das Sokratische Gesprch In Theorie Und Praxis - Der Rastlose Mensch - Der Sdosten Verkehrspolitisch Betrachtet - Jugend Joystick Musicbox - Die Landwirtschaftliche Verwertung Stdtischer Abwsser - Wirtschaftswrterbuch Diccionario Econ³mico - Auf Dem Wege Zu Einer Anthropologischen Psychiatrie - Wissenschaftliches Arbeiten In Den Wirtschafts- Und Sozialwissenschaften - Radiology Of The Small Intestine - Funktionentheorie Und Ihre Anwendung In Der Technik - Missvergngen - Histologie Und Mikroskopische Anatomie - Neoplasms Of The Liver - –kosystemforschung Der Rhein Und Seine Auen - Particle Physics And Astrophysics Current Viewpoints - Real-world Problems For Secondary School Mathematics Students - Macht Markt Meinungen - Taxation Of European Companies At The Time Of Establishment And Restructuring - Die Forstliche Statik - Karrierewege Als Thema Der Internen Kommunikation - Die Meywandler - Handbuch Der Jugendforschung - Alle Wege Hren Zum Menschen - Die Cdu - Mechanische Schwingungen Und Ihre Messung - Die Medizin An Der Berliner Charit© Bis Zur Grndung Der Universitt - Erster Unterrieht Des Jungen Drogisten - Ostmitteleuropa Ruyland Und Die Osterweiterung Der Nato - Distribution Und Handel In Theorie Und Praxis - Vom Elfenbeinturm Ins Rampenlicht - Looking To The Future - Phytohormones And Abiotic Stress Tolerance In Plants - Jungquartre Landschaftsrume - Soziale Arbeit In Der Sozialhilfe - Der Altersprsident - The Biology Of Subcellular Nitric Oxide - Photon-vegetation Interactions - Hhere Mathematik Mit Mathematica - Leitfaden Der Therapie Der Inneren Krankheiten - Das Bdm-werk „glaube Und Schnheit - Monoclonal Antibodies - Kern- Und Radiochemie - Elektronische Information In Der Hochschulausbildung - A Practical Guide To Human Cancer Genetics - Fluid- Und Wrmetransport Strmungslehre - Grundlagen Und Methoden Der Periodenforschung - Comparative Mammalian Cytogenetics - Soziologie Als Oppositionswissenschaft - Friedrich Engels Eine Biographie - Die Wirkungsweise Der Rektifizier- Und Destillier-apparate Mit Hilfe Einfacher Mathematischer Betrachtungen - Plurale Sozialstrukturanalyse - Die Kessel- Und Maschinenbaumaterialien Nach Erfahrungen Aus Der Abnahmepraxis Kurz Dargestellt Werksttten- Und Betriebsingenieure Und Konstrukteure - Technologiegesttzte Dienstleistungsinnovation In Der Gesundheitswirtschaft - Technischer Lehrgang Kupplungen - Peter Weiss Jahrbuch 3 - Grundlagen Der Geometrischen Datenverarbeitung - Was Jetzt - Fremdstoffe In Lebensmitteln - Handlungswissen Der Sozialen Arbeit - Das Kraftfahrzeug - Lehrbuch Des Stahlbetonbaues - Aktiengesellschaft Und Holdinggesellschaft In Der Schweiz Geltendes Recht Und Revision - Erwerbsarbeit Und Unterhaltswirtschaft - Lehrbuch Der Gesteins- Und Bodenkunde - Eh-ph Diagrams For Geochemistry - Nanorobotics - Bildungsgangdidaktik - Leben In Der Stadt - Exergie - Einhrung In Die –lhydraulik - Bifurcation And Chaos In Engineering - œbungsbuch Zur Angewandten Wahrscheinlichkeitstheorie - Raising Public Awareness Of Mathematics - Die Politische Philosophie Michael Walzers - Methodology Ecological Genetic And Nutritional Effects On Growth - Identification Of Materials - Soziale Pathologie - Kommunale Strategien Gegen Massenarbeitslosigkeit - Investitionsrechnung - Geschichte Der Rbe Beta Als Kulturpflanze - H Rietschels Leitfaden Der Heiz- Und Lftungstechnik - Programmprofile Kommerzieller Anbieter - Handbuch Der Rohrleitungen - Die Entropie-diagramme Der Verbrennungsmotoren Einschlieylich Der Gasturbine - Caryophyllales - C Als Erste Programmiersprache Iso-standard - The House Mouse - Grundbegriffe Des Preuyischen Wegerechts - Vergleichende Politikwissenschaftliche Methoden - Beweissicherung Im Bauwesen - Programmierkurs Turbo-pascal - Electromagnetic Field Theory - Rechtsextremismus In Den Usa - Das Politische System Polens - The Endothelins - Therapie Der Angina Pectoris Mit Teopranitol - Sip Die Technik - Sprachkompetenz Tageszeitungsnutzung Und Politikorientierung Von Einwanderern - Freytags Hilfsbuch Den Maschinenbau Maschineningenieure Sowie Den Unterricht An Technischen Lehranstalten - Atlas Of Brain Tumors - Peptides - Mnnerbnde Und Massen - Genetic Engineering 3 - Ren© Knig Soziologe Und Humanist - Innere Sekretion - Lehrbuch Der Hygiene - Corporate Identity In Banken - 100 Jahre Schiffbautechnische Gesellschaft - Elektrische Maschinen Und Antriebe - Intellektuelles Kapital Und Wettbewerbsfhigkeit - Strategisches Management - New Trends In Computer Graphics - Prozey- Und Methoden-management Informationssysteme - Modell „bad Bank Hintergrund - Konzept - Erfahrungen - Aufwertung Der Erziehungsarbeit - Einhrung Wirtschaftsinformatik - Welfare And Efficiency In Public Economics - Politik Und Tod - Linguistic Identity Matching - Green Business Process Management - Neue Entwicklungen In Der Therapie Von Lebertumoren - Mediensoziologie - Die Gleichstrommaschine Ihre Theorie Untersuchung Konstruktion Berechnung Und Arbeitsweise - Interdisziplinre Managementforschung Und -lehre - Politbarometer - Wie Vorhersagbar Sind Grundschulnoten - Telekommunikationsanwendungen Kleine Und Mittlere Unternehmen - Testamentsvollstreckung - Fachwerk Und Rahmenwerk - Wirtschaftliche Entwicklung Bei Schrumpfender Bevlkerung - Angewandte Gestalttheorie In Psychotherapie Und Psychohygiene - Zur Aktualitt Von Jean Baudrillard - Nationale Mindestsicherungssysteme Und Europische Integration - Molecular Theory Of The Living Cell - Cad And Office Integration - Mensch Und Kultur - Die Wohlfahrtspflege - Automation Of Cytogenetics - Datenbertragung Nachrichtentechnik In Datenfernverarbeitungssystemen - Software-entwurf In Pearl-orientierter Form - Konfrontative Pdagogik - Die Synchronen Wechselstrommaschinen Generatoren Motoren Und Umformer Ihre Theorie Konstruktion Berechnung Und Arbeitsweise - Atlas Der Normalen Und Pathologischen Handskeletentwicklung - Die Elektrische Beleuchtung Von Eisenbahnfahrzeugen - Fremdenfeindliche Gewalttter - Grundlagen Der Gasdynamik - Systemprogrammierung In Unix Linux - Hiv Betroffene Und Ihr Umfeld - Historische Studien Und Skizzen Zu Natur- Und Heilwissenschaft - Common Dilemmas In Family Medicine - Die Halboffenen Anstalten Kleinkinder - Biogeography And Taxonomy Of Honeybees - Unix Software-entwickler - Handbuch Jugend Und Musik - Technische Messungen Bei Maschinenuntersuchungen Und Zur Betriebskontrolle - Eskalation Durch Berichterstattung - Tuberculosis Of The Skeleton - Einmal Verbrecher Immer Verbrecher - Exploding Markets - Der Gesetzgeber - Advances In Turbulence 3 - Psychotherapie Als Transformationsprozey - Finanzvertrge Und Finanzintermediation - Differentialdiagnose - Discrete-time Linear Systems - Coronary Artery Graft Disease - Gleichstellungsorientierte Arbeit Mit Mdchen Und Jungen Frauen - Die Umworbene Gesellschaft - Die Nierenfunktionsprfungen Im Dienst Der Chirurgie - Die Digitale Revolution - Formeln Und Lehrstze Zum Gebrauche Der Elliptischen Functionen - Grundlagenwissen Medien Journalisten - Tokolyse Und Betamimetika - C4-hydrocarbons And Derivatives - Pathways In Applied Immunology - Die Apotheken Gesetzgebung Des Deutschen Reiches Und Der Einzelstaaten Auf Der Grundlage Der Allgemeinen Politischen Handels- Und Gewerbegesetzgebung Dargestellt - Programmieren Mit Modula-2 - Die Akuten Erkrankungen Der Gaumenmandeln Und Ihrer Unmittelbaren Umgebung - Politik Und Gedchtnis - Power Supply In Telecommunications - Demokratie Und Partizipation - Brgerinitiativen Und Reprsentatives System - Unfallforschung Unfallmechanik Und Unfallrekonstruktion - Talk Auf Allen Kanlen - Handbuch Freie Journalisten - Radiobiology In Radiotherapy - Handbuch Der Astrofotografie - Computer-generated Images - Biomaterials For Surgical Operation - Lectins And Cancer - Human Hemoglobin Genetics - Entropie Ingenieure - 100 Grafik-rezepte Turbo Pascal Unter Windows - Illustrated Computer Tomography - Territorium Und Groystadt - Diagnostische Hmatologie - Relativistic Quantum Mechanics - Der Krebs Der Gebrmutter - –ffentlichkeit Und Sprachwandel - Programmpolitik Zwischen Markt Und Moral - Aktiv Und Gesund - Das Objekt-paradigma In Der Informatik - Repetitorium Mathematik - Die Verstimmte Demokratie - Die Gelenksilhouette - Der Wirkungsgrad Von Dampfturbinen Beschauflungen - Belastung Und Beanspruchung Im Lehrerberuf - Grundriss Der Gesamten Chirurgie - Grundzge Des Eisenhttenwesens - Lehrbuch Der Infektionskrankheiten „rzte Und Studierende - Angewandte Diskursforschung - Einhrung In Die Methoden Der Empirischen Soziologie - Caddy Grundkurs - Handbuch Sekretariat - Sonographie Des Gastrointestinaltrakts - Hydrotherapie Elektrotherapie Massage - Lehr- Und Lernkompetenz Erwerben - Management And More - Die Deutsch-polnischen Beziehungen 19492000 - Bibliographie Der Luftfahrtmedizin - Geoelektronik - Effizient Lesen - Metallfachkunde 5 - Computer Science And Statistics Proceedings Of The 13th Symposium On The Interface - Azospirillum Iv - Induktionsmaschinen - Die Chromgerbung - Grenzgeschwindigkeiten Und Ihre Paradoxa - Kurze Geschichte Der Katalyse In Praxis Und Theorie - Die Wohlfahrtsverbnde Im Ns-staat - Professionalitt Sozialer Arbeit Und Hochschule - Kesselbetrieb - Tragwerkslehre - Chromosomal Alterations - Die Feldschwchung Bei Bahnmotoren - Life Politics - Hydrothermal Mineral Deposits - Kommunikationswissenschaft Und Gender Studies - Die Wissenschaftlichen Grundlagen Des Rundfunkempfangs - Medikamentse Behandlung Des Postinfarktpatienten Nach Cast - Rechnen Reiseverkehrskaufleute - Demokratie In Der Kleinstadt - Eigentumswohnungen Als Kapitalanlage - Griechische Staatsaltertmer - Chemie Der Zuckerindustrie - Verminderung Des Verkehrslrms - Welfare Effects Of Value-added Tax Harmonization In Europe - Karl Mannheims Analyse Der Moderne - Aufgabensammlung Elektrotechnik 2 - Population Biology - Dbase Iv Einsatz In Lokalen Netzwerken Lan - Politische Eliten In Slowenien Und Makedonien - Variable Stars - Leitbilder Von Gestern - Leben In Benachteiligten Wohngebieten - Die Architekturen Der Menschlichen Knochenspongiosa - Die Macht Der Identitt - Entwicklung Der Geburtshilfe Und Gynkologie Im 19 Jahrhundert - Gestalttheorie Und Psychotherapie - Klinische Physiologie - Eine Kurze Einhrung In Die Systemtheorie - Erluterungen Zu Den Normalien Isolierte Leitungen In Starkstromanlagen Den Normalien Isolierte Leitungen In Fernmeldeanlagen Sowie Den Kupfernormalien - Surgical Thoracoscopy - Phantasie Und Realitt In Der Sptadoleszenz - Ohne C Zu C++ - Dv-projektrecht - Variations And Connections Of The Human Thalamus - Mobilitt Im Kindes- Und Jugendalter - Robotics And Factories Of The Future 87 - Supply Chain Scheduling - Parteisoldaten Und Rebellen - Studium Und Arbeitslosigkeit - Olfaction And Odours - Familientypen Und Formen Auyerfamilialer Kinderbetreuung Heute - Interaktionale Rezeptionsforschung - Engineering Mathematics - Advances In Superconductivity V - Telearbeit - Elektrotherapie - Der Markt Der Gesellschaft - Handeln In Einer Hungerkrise - Forschung Und Technik - Primary And Secondary Metabolism Of Plant Cell Cultures Ii - Kapitalstrukturpolitik Deutscher Brsennotierter Aktiengesellschaften - Meyverfahren Der Experimentellen Mechanik - Handbuch Kindheits- Und Jugendforschung - Bone Marrow And Bone Tissue - Huser - Foundations Of Mathematics - Die Entwicklung Des Menschen Vor Der Geburt - Mglichkeitssinn - Baader-meinhofs Kinder - Zukunftsgenese - Physics Of Active Galactic Nuclei - Dynamic Capabilities Als Einflussfaktoren Des Markteintrittstimings - Production Systems And Supply Chain Management In Emerging Countries Best Practices - Functional Analysis And Economic Theory - Konzertierung Verhandlungsdemokratie Und Reformpolitik Im Wohlfahrtsstaat - Einhrung In Die Empirische Literaturwissenschaft - Radiological Exploration Of The Ventricles And Subarachnoid Space - Dringliche Thoraxchirurgie - Steine Und Steinbrche Im Alten „gypten - Verantwortung - Anfangsgrnde Der Chemie - Soziale Struktur Und Wissenschaftliche Praxis Im Wandel - Renal Cell Carcinoma - Generation Und Gedchtnis - Lehrbuch Der Toxikologie Studium Und Praxis - Lebenslagen Im Strukturwandel Des Alters - Kind Und Wohnen - Deutsche Migrationspolitik Im Neuen Europa - Werte Und Wertewandel In Westlichen Gesellschaften - Between Two Worlds” Hans Gerth - Cyclic Amp Cell Growth And The Immune Response - Erfolgreiche Anzeigen - Geld- Und Bankwesen - Gewaltdarstellungen In Den Medien - Die Nahaufnahme - Fokus Kunde - –kologie Und Urbane Lebensweise - Strategische Personalplanung - Deutschland Und Polen Eine Werte- Und Interessengemeinschaft - Fragile Sozialitt - Das Kreditgeschft In Der Abschluyprfung Von Bankkaufleuten - Die Spinnerei In Technologischer Darstellung - Silicon In Polymer Synthesis - Introduction To Abdominal Ultrasonography - Bevlkerungswissenschaft Quo Vadis - Realm Of Tolerance - Cardiac Glycoside Receptors And Positive Inotropy - 1+1=10 Mathematik Hhlenmenschen - Bedarfsorientierte Kinderbetreuung - „elemente Der Informatik - Die Lernende Bankorganisation - Hrung Neu Verorten - Die Strafe I - Nonlinear Finite Element Analysis In Structural Mechanics - Die Betriebswissenschaft Des Eisenbahngtertarifs - Analyse Der Fette Und Wachse Sowie Der Erzeugnisse Der Fettindustrie - Altern „uyere Realitt Innere Wirklichkeiten - Handbuch Gefahrstoffbeauftragte - Freizeit In Der Erlebnisgesellschaft - Advances In Genetics Development And Evolution Of Drosophila - Dienstleistungs-management - Unternehmensfinanzierung Mit Dem Kapital-dienstleistungsgrad - Nacktheit - Applied Mathematics For Database Professionals - Politikkompetenz - Das Politische System Belgiens - Afrika Jahrbuch 1995 - Assessment And Management Of Hepatobiliary Disease - Spielregeln Den Umgang Mit Chefs - Altern Als ‚gesellschaftliches Problem‘ - Advances In Digital Image Processing - Kolbendampfmaschinen Und Dampfturbinen - Die Gegenwrtigen Strmungen In Der Psychiatrie - Hrtbarkeit Und Auswahl Von Sthlen - Metallische Implantate In Der Knochenchirurgie - Bibliographie Der An Den Deutschen Technischen Hochschulen Erschienenen Doktor-ingenieur-dissertationen In Sachlicher Anordnung 1900 Bis 1910 - Papierchromatographie In Der Botanik - Rheumaorthopdie Untere Extremitt - Paediatric Pathology - Autonome Neuropathie Bei Diabetes Mellitus - Zeitreihenanalyse In Den Wirtschaftswissenschaften - Stiftungsvermgen 2010 - Die Soziologen Und Das Recht - Bevlkerung · Umwelt · Entwicklung - The Central Nervous System In Aids - Der Einfluss Tiefer Atmung Auf Den Herzrhythmus Sinusrhythmus Und Seine Klinische Verwendung - Die Logik Des Politikwissenschaftlichen Experiments - Beitrge Zum Verfassungs- Und Wirtschaftsrecht - Grne Parteien In Westeuropa - Staat Und Medien - First Leaves A Tutorial Introduction To Maple V - Bundestagswahl 2002 - Corporate Agility Organization - Personalarbeit Der Zukunft - Der Friedensvertrag Und Deutschlands Stellung In Der Weltwirtschaft - Mitarbeiterzeitschriften Noch Besser Machen - Einheit Der Wissenschaft - Entwerfen Und Berechnen Der Dampfturbinen - Trennung Von Molekularen Mischungen Mit Hilfe Synthetischer Membranen - Soziologische Aufklrung 4 - Handbuch Der Zahnheilkunde - Stochastic Optimal Control And The Us Financial Debt Crisis - Das Gebiss Des Menschen Und Der Anthropomorphen Vergleichend-anatomische Untersuchungen - Moderne Stahlgieyerei Unterricht Und Praxis - Allgemeine Literaturwissenschaft - Handbuch Messemanagement - Visual Geometry And Topology - Stadtentwicklung Gotha 19902000 - Analyse Der Fette Und Wachsarten - Kolloidchemische Grundlagen Der Textilveredlung - Uncertainty And Forecasting Of Water Quality - Geschlechter - Judith Butler Pdagogische Lektren - Maple Griffbereit - Romantik Und Gewalt - Perugia Consensus Conference On Antiemetic Therapy - Marketing Den Mittelstand - Intersections Without Traffic Signals Ii - Effizienz Im Marketing - Women Leaders At Work - Kabel-herstellung - Surgery Of The Sellar Region And Paranasal Sinuses - Elektromagnetische Vertrglichkeit - Lectures On Developmental Physiology - Die Neuzeitliche Seidenfrberei - Die Politische Deutungskultur Im Spiegel Des „historikerstreits - Die Sozialstruktur Deutschlands Im Internationalen Vergleich - Aktuelle Neuropdiatrie 1988 - Gender From Costs To Benefits - Turbulenzen Im Transformationsprozey - Kooperation Von Jugendhilfe Und Schule - Verwaltungscontrolling - Elektronengerte - Fachbegriffe Internationale Rechnungslegungglossary Of International Accounting Terms - Peripheralization - Lokale Politik Und Verwaltung Im Zeichen Der Krise - Computational Fluid Dynamics - Problemkreis Altlasten - Assembly Of Enveloped Rna Viruses - Kulturen Vergleichen - Der Schwierige Weg Zur Demokratie - Methoden Und Modelle Des Operations Research - Die Kulturelle Bedeutung Der Komplexen Psychologie - Die Eisenbahn Im Wirtschaftsleben - Das Managementmodell Der Jesuiten - Jahrbuch Verkaufstraining 20002001 - Lebendige Krfte - Host Defense Dysfunction In Trauma Shock And Sepsis - Milde Hypertonie - Querdenken Im Marketing - Leistung Aus Kultur - Dehnungsmeystreifentechnik - Trusts In Deutschland - Erfolgsfaktor Ich - Corba - Corporate Reputation Management - Kundennutzen Die Basis Den Verkauf - Fallarbeit In Der Universitren Lehrerinnenbildung - Ergebnisse Der Inneren Medizin Und Kinderheilkunde - Alterssicherung Von Frauen - Elemente Der Mechanik Iv - Protein-calorie Malnutrition - Die Klassischen Sttten Von Jena Und Jlmenau - Der Deutsche Frauenrat - Physics At Kaon - Vorlesungen Ber Numerische Mathematik - Systematic Introduction To Expert Systems - Stiftungen 2011 - Argumenta Papiniani - Geschichte Der Medizinisch-biologischen Institute Berlin-buch - Die Feinplanung Von Dv-systemen - Die Inhalationsnarkose - Elemente Der Chemie-ingenieur-technik - Spielen In Virtuellen Welten - Cad Werkzeug Des Architekten - Ii Chemischer Teil - Programmieren In C++ Borland-versionen - Soziologie Des Cyberspace - Schaltungen Der Datenverarbeitung - Developments In Laser Techniques And Applications To Fluid Mechanics - Die Konstitutionelle Disposition Zu Inneren Krankheiten - Die Stdte In Den 90er Jahren - Gleitlager - Gehirnkrankheiten - Physical Processes In Comets Stars And Active Galaxies - Mortalin Biology Life Stress And Death - Burn Care And Treatment - Der Flotations-prozess - Exploration Of Halley Comet - Islamverherrlichung - Stochastik Mit Mathematica - Evolution Of Information Processing Systems - Die Methode Der Tauschwerthe - Heterocyclic Chemistry - Soziologische Gegenwartsdiagnosen Ii - Psychotherapie In Der Medizin - Vierpoltheorie Und Frequenztransformation - Kritische Empirie - Erfolgreich Gegen Kopfschmerzen Und Migrne - Packetc Programming - Die Klinik Der Entschdigungspflichtigen Berufskrankheiten - Internationale Kooperationen Und Joint Ventures - Clinical Pharmacology Of Anti-epileptic Drugs - Sap Erp - Praxishandbuch Projektmanagement - Mathematics Today Twelve Informal Essays - Investmentrecht - Kulturpdagogik - Antriebstechnik In Der Metallverarbeitung - Zirkulre Positionen - Information Zwischen Interpretation Und Kritik - Integrated Pollution Control - Baubetriebspraxis - Bestallungsordnung „rzte Und Prfungsordnung Zahnrzte - Grundlagen Der Reprsentativen Statistik - Isotopes Of The Earths Hydrosphere - Nachhaltige Nutzung Von Wrmeenergie - Speicheldrsenerkrankungen - Advances In Data Base Theory - Language Grounding In Robots - Lehrbuch Der Diagnostischen Und Operativen Cystoskopie - Digitale Nachrichtenbertragung - Netzwerk Weltpolitik - Elites In Transition - Wortgefecht Und Sprachverwirrung - –ffentliches Baurecht Praxisnah - Dosimetrie Der Strahlungen Radioaktiver Stoffe - Rubber Technology - Migrantenjugendliche Zwischen Schule Und Beruf - Die Verfestigung Der Metalle Durch Mechanische Beanspruchung - Laplace- Fourier- Und Z-transformation - Clinical Facial Analysis - Fremde Kulturen Im Europischen Fernsehen - Riskante Entscheidungen Und Katastrophenpotentiale - Elementare Moderne Physik - Attention Deficit Hyperactivity Disorder Handbook - Konstruktion Und Material Im Bau Von Dampfturbinen Und Turbodynamos - Leitfaden Der Medizinisch-klinischen Propdeutik - Ambulantes Operieren Der Neue Weg In Der Gynkologie - The Pyloric Sphincteric Cylinder In Health And Disease - Immobilien Investment - How Institutions Change - Viruskrankheiten Des Menschen - Das Giessen Von Messingblcken - Pestizide Und Umweltschutz - Handbuch Handel - Mixed Reality - Equilibrium And Kinetics In Contact Metamorphism - Lehrbuch Der Chirurgischen Krankenpflege - Schulabbrecher In Unserem Bildungssystem - Automatische Fahrzeuggetriebe - Handbuch Altenbildung - Metallurgie Der Ferrolegierungen - Lehrbuch Der Markscheidekunde - Die Auyenpolitik Der Baltischen Staaten - Kolloidchemie - Die Corporate Social Responsibility-politik Der Europischen Kommission - Handbuch Soziale Probleme - Soziologie Und Sozialgeschichte - Cobol 85 Auf Dem Pc - Analysis Of Solids In Natural Waters - Umwandlungssteuer - Glcksvorstellungen - Gewollte Und Ungewollte Schwankungen Der Weiblichen Fruchtbarkeit Bedeutung Des Kohabitationstermines Die Hufigkeit Der Knabengeburten - Die Bedeutung Europas In Der Auyenpolitik Der Usa - Leitfaden Der Gynkologie - Vermessungskunde - Familienleitbilder Und Familienrealitten - Leichte Dampfantriebe An Land Zur See In Der Luft - Das Elektrostahlverfahren - Langzeitverlufe Und Sptresultate Bei Querschnittlhmung - Der Psychopath - Der Mensch In Der Psychiatrie - Acht- Und Neunstellige Tabellen Zu Den Elliptischen Funktionen Eight And Nine Place Tables Of Elliptical Functions - Umweltorientierte Marktwirtschaft - Die Zukunft Des Journalismus - Soziologie Im Nationalsozialismus Zwischen Wissenschaft Und Politik - Klinik Und Therapie Der Vegetativen Funktionsstrungen - Dampfturbinenkraftwerke Kleiner Und Mittlerer Leistung - Die Oxydativen Grungen - Grundkurs Verteilte Systeme - Selbstorganisation Und Public Value - Genetic Effects Of Air Pollutants In Forest Tree Populations - Scherzkommunikation - Soziologische Aufklrung 1 - Die Leistungssteigerung Von Groydampfkesseln - Grundzge Der Technischen Wirtschafts- Verwaltungs- Und Verkehrslehre - Die Konomische Dynamik Politischer Herrschaft - Fuzzy-theorie Oder Die Faszination Des Vagen - Algorithmen Ingenieure - Regionale Modernisierungspolitik - Michel Foucault Pdagogische Lektren - Einhrung In Die Soziologische Gesellschaftsanalyse - Transformation Der Verbndedemokratie - Chemie Des Waffen- Und Maschinenwesens - Gerontopsychiatrie Und Alterspsychotherapie In Deutschland - Migration Aus Afrika In Die Eu - John Charnley - Einhrung In Die Mechanik Und Akustik - Vorlesungen Ber Hhere Geometrie - Global Environmental Security - Statistische Methodenlehre Wirtschaftswissenschaftler - Surgery Of Vertebrobasilar Aneurysms - Sorgende Arrangements - Handbuch Der Verkehrsmedizin - Dna Replication The Regulatory Mechanisms - Social Costs Of Energy - œbungsbuch Strmungsmechanik - Polyimides - Interaktionsplattformen Und Kundenintegration In Industriegtermrkten - Der Pauli-jung-dialog Und Seine Bedeutung Die Moderne Wissenschaft - Grundriss Der Botanik - Frieden Als Form - Metaphysik Skepsis Wissenschaft - Automatisierungstechnik Kompakt - Kommunitarismus - Die Trockentechnik - Tumormarker Und Immunszintigraphie In Der Gynkologischen Onkologie - Mnnlichkeiten Gemeinschaften Nationen - Therapie Mit Gallopamil - Brcken - Der Arbeiterschutz In Den Preussischen Bergpolizeiverordnungen - Literatur In Der Funktional Differenzierten Gesellschaft - Herausforderungen An Die Innovationskraft Der Verwaltung - Wege Zum Raum - Ein Bewegtes Gelehrtenleben - Effektives Compliance Management In Unternehmen - Interferone - Cultural Diversity In The Classroom - Lineare Algebra Und Lineare Programmierung - Nucleic Acids In Immunology - Journalismus Als Soziales System - Fokussiertes Business Design - Afrika Jahrbuch 2003 - Die Chemie Des Lignins - Mathematik Informatiker - Der Geburtshilfliche Phantomkurs In Frage Und Antwort - Die Biochemie Des Karzinoms - Die Deflation Und Ihre Praxis In England · Den Vereinigten Staaten · Frankreich Und Der Tschechoslowakei - Der Bauingenieur In Der Praxis - Die Elektrischen Ausrstungen Der Gleichstrombahnen Einschlieylich Der Fahrleitungen - Brokaufleute - Neurosecretion - Handbuch Medienselbstkontrolle - Gammopathy - Forest Decline In The Atlantic And Pacific Region - Soziologische Aufklrung 1-6 - Asbest Und Lunge - Der Bundestag - Glcksspiel - Medien Und –konomie - Gesundheitsbchlein - Jenseits Von Halley - Angewandte Tierzucht Auf Rassenbiologischer Grundlage - Entscheidungen In Der Individualisierten Gesellschaft - Auslndische Jugendliche In Der Berufsausbildung - Dieselmotoren In Der Elektrizittswirtschaft Insbesondere Spitzendeckung - Die Brennkraftmaschinen - Change Power - Deutschland In Einer Neuen Weltra - Corporate Hospitality Bei Sportevents - Adrenergic System And Ventricular Arrhythmias In Myocardial Infarction - Gruppenprozesse Verstehen - Umweltforschung Und –ffentlichkeit - Chemische Unterrichtsversuche - Gewhnliche Und Operator-differentialgleichungen - Berufsausbildung In Der Ddr - Technik Aus Soziologischer Perspektive 2 - Beitrge Zur Kenntniss Der Baumkrankheiten - Fernsehnachrichten - Werkzeugspanner Werkzeughalter - Pathologie Der Ableitenden Harnwege Und Der Prostata - Starthilfe Finanz- Und Rechnungswesen - Psychotic Continuum - Mikrosystemtechnik Auf Silizium - Food Analysis - Pharmakopsychologie Und Psychopathologie - Parteien Und Fraktionen - Jugend Und Gewalt - Die Beziehung Von Unternehmenskultur Und Unternehmensmarke - Die Unspezifischen Bluteiweissreaktionen - Steuerstandort Groybritannien - Ratschlge Zum Mathematischen Umgang Mit Ungewiyheit - Forest Decline And Atmospheric Deposition Effects In The French Mountains - Assembler- Programmierung Mit Dem Pc - Production Wine Analysis - Journalismus Als Beruf - War Der Wissenschaftliche Kommunismus Eine Wissenschaft - Die Mannich-reaktion - Vernunft Angesichts Der Umweltzerstrung - Nahost Jahrbuch 2002 - Einhrung In Die Elektronik - Franzsische Apotheken-praxis - Der Beckenboden Der Frau - Berufsfindungsprozesse Von Mdchen Und Jungen Frauen - Die Hypertoniekrankheiten - Coil Coating - Moderne Geriatrie Und Akutmedizin - Kompetenzentwicklung In Netzwerken - Physik Im Experiment - Handbuch Die Bekleidungsindustrie Und Den Bekleidungs-einzelhandel - Handeln Und Handeln Lassen - Die Constantinische Schenkungsurkunde - Vom Ornament Zum Nationalkunstwerk - Friedrich Wieser Als Soziologe - Frauen Arbeit Und Individualisierung - Whrungsoptionen - Die Ideen Community Zur Integration Von Kunden In Die Frhen Phasen Des Innovationsprozesses - Beginning Facebook Game Apps Development - Microcirculation In Circulatory Disorders - Einhrung In Die Lineare Und Nichtlineare Optimierung Ingenieure - Pro Multithreading And Memory Management For Ios And Os X - Multidisciplinary Management Of Rectal Cancer - Nahost Jahrbuch 1990 - Inhaltsanalyse - Metallurgische Technologie - Die Befreiung Der Politik - Concepts In Hypertension - Das Bild Des Kranken - Dasselbe Noch Einmal Die „sthetik Der Wiederholung - Moderne Stabilisierende Verbnde - –kologie Und Wasserbau - Politischer Extremismus In Der Bundesrepublik Deutschland - Die Verhtung Von Gesundheitsschdigungen Durch Anklopfmaschinen Die Verhtung Der Anklopferkrankheit - Pps-systeme Und Organisatorische Vernderungen - Wege Zum Projektorientierten Unternehmen - Kindheit In Armut Weltweit - Generationen Und Sozialer Wandel - Geld Und Geschlecht - Essentials Of Ultrasonography - Technischer Lehrgang Hydraulische Systeme - Organisationsentwicklung Und Organisationales Lernen Von Schulen - Die Operative Beseitigung Der Bauchbrche Die Eingriffe An Den Weiblichen Geschlechtsorganen - Das Gesundheitswesen In Der Bundesrepublik Deutschland - Weininvestment - Statistik-œbungen - Kritische Kriminologie In Der Diskussion - Tragwerke Aus Aluminium - Die Verwsserung Von Erdlfeldern Ihre Ursachen Und Bekmpfung - Psychiatrie In Der Literatur - Living With Paradoxes - Medienstadt - Modern Food Analysis - Werkzeugmaschinen - Euro-bankmarketing - Degenerative Gefyerkrankungen - Quantum Mechanics On The Personal Computer - Eisenbahn-balkenbrcken - Business Ethics - Ethics In Reproductive Medicine - Korruption In China - Achieving Systems Safety - Mechanoreceptors - Schulautonomie Wohlfahrtsstaat Und Chancengleichheit - Internalisierung Und Strukturbildung - Non-fibrillar Amyloidogenic Protein Assemblies - Common Cytotoxins Underlying Degenerative Diseases - Investment Banking - Diskursanalysen 2 Institution Universitt - Elektrokeramik - A Strategic Fit Perspective On Family Firm Performance - Theorien Des Journalismus - Wege Zu Neuen Arzneimitteln - Klassiker Des Managements - Die Seele Im Unternehmen - Chemiker-taschenbuch - Aufgaben Der Eisenbahn-politik - Internationale Umweltpolitik - Atlas Der Anatomie Des Menschlichen Krpers Im Rntgenbild - Patch Testing And Prick Testing - Fieber - Schlackenkunde - Robotersysteme 1 - Muscle Transplantation - Intensivmedizinische Praxis - Das Bestseller-phnomen - „rztliche Merkbltter Ber Berufliche Erkrankungen - Medienjournalismus - Soziologische Aufklrung 2 - Transforming Ethnopolitical Conflict - Jucs The Journal Of Universal Computer Science - Mathematische Bildung Und Neue Technologien - Grundzge Der Praktischen Pharmazie - Ditetik Der Stoffwechselkrankheiten - Macht Und Moral - Wolfgang Abendroth Wissenschaftlicher Politiker - Aufgaben Der Eisenbahn - Politik - Konfigurationen Lebensweltlicher Strukturphnomene - Medienentwicklung Und Gesellschaftlicher Wandel - Ostdeutschland - The Paraneuron - Freiheitsverlust Und Freiheitsentziehung - Performativitt Und Medialitt Populrer Kulturen - Die Pflanzenzucht Im Walde - Das Kupferschweiyverfahren Insbesondere Bei Lokomotiv-feuerbchsen - Konstruktion Und Kritik - Steuerliche Wahlrechte - Die Gesellschaftliche Verankerung Politischer Parteien - Semiconductor Physics - Adaptations To Terrestrial Environments - Der Arbeitslohn Und Die Soziale Entwicklung - Zugnge Die Fixateur-externe-osteosynthese - Folgen - Angewandte Mathematik Modellbildung Und Informatik - Friedhofsgesprche - Deutschland Als Neue Heimat - Der Konstitutionstypus - –ffentliche Sozialforschung Und Verantwortung Die Praxis - Biologische Auswertungsmethoden - Anorganisch-nichtmetallische Werkstoffe - Grundlagen Und Rechenverfahren Der Elektrotechnik - Berechnung Der Kltemaschinen Auf Grund Der Entropie-diagramme - Knstliche Organische Farbstoffe Und Ihre Zwischenprodukte - Finanzmathematik Mit Matlab - Die Zweckmssigkeit In Der Entwicklungsgeschichte - Neue Amerikanische Verkaufs- Und Lagerverfahren - Wissenssoziologie Sozialer Probleme - Klinische Pathophysiologie Der Atmung - Handbuch Stress Und Kultur - Handbuch Medienerziehung Im Kindergarten - –ffentlichkeit - Beispiele Zur Bemessung Von Betontragwerken Nach Ec 2 - Hyperurikmie Gicht Und Andere Strungen Des Purinhaushalts - Freiheit Wovon Freiheit Wozu - Programmierte Einhrung In Die Betriebswirtschaftslehre - Globalisierung Partizipation Protest - Quantenmechanik Und Weimarer Republik - Lernplattformen In Schulen - X-ray Microscopy - Der Einsatz Der Bundeswehr In Afghanistan - Vorschriftsgemyes Entwerfen Nach Bauordnungen Normen Richtlinien Und Regeln - Muskel Training 2000 - Starthilfe Bwl - Schritte Zum Nachhaltigen Unternehmen - Grundkurs Programmieren Mit Delphi - Die Einzelhaus-wasserversorgung - Bussysteme In Der Automatisierungs- Und Prozesstechnik - Eigentumsvorbehalt Und Abzahlungsgeschft - Das Elektrokardiogramm - Die Im Kriege 19141918 Verwendeten Und Zur Verwendung Empfohlenen Brote Brotersatz- Und Brotstreckmittel - Controlling Mit Sap - Physical Processes In Estuaries - Erfolgreiches It-management Im Ffentlichen Sektor - Wohnstandortprferenzen Und Mobilittsverhalten - Das Versuchswesen Auf Dem Gebiete Der Pflanzenphysiologie Mit Bezug Auf Die Landwirthschaft - Technology Acceptance In Education - Multimedia Und Multi-moderne Schlsselbilder - Stahl- Und Verbundkonstruktionen - Krebsforschung In Deutschland - Marine Mammals And Seabirds In Front Of Offshore Wind Energy - Bau Groyer Elektrizittswerke - Font Technology - Gas Flow And Chemical Lasers - Umwelt- Und Technikkonflikte - Gegekunde Der Gesteine - Soziologische Beratungsforschung - Grundkurs Computergrafik Mit Java - Electronic Business Und Mobile Business - Anleitung Zur Qualitativen Analyse - Modernisierung Des –ffentlichen Dienstes - High Value Management - Der "ossi" - Der Jugoslawien-krieg - Parlamente Und Ihre Funktionen - Performance Und Skalierung Von Sap Erp Systemen In Virtualisierten Umgebungen - Die Theorie Elastischer Gewebe Und Ihre Anwendung Auf Die Berechnung Biegsamer Platten - Kalkulierte Kreativitt - Ehrenamt Und Brgerschaftliches Engagement Im Recht Ein Ratgeber - Der Das Unendliche Kannte - Wem Gehrt Der Ffentliche Raum - Vernetzung Als Soziales Und Technisches Paradigma - Endocytosis - Erfolgreich Projekte Leiten - Die Behandlung Der Chronischen Encephalitis Epidemica Parkinsonismus Mit Der „bulgarischen Kur - Risk Assessment For Deliberate Releases - Funktionelle Sonographie In Gynkologie Und Reproduktionsmedizin - Der Kampf Um Das Sozialistengesetz 1878 - Junge Frauen Heute Wie Sie Leben Was Sie Anders Machen - Propan-butan - Semantik Der Deixis - Lexikon Statistik - Anschauliche Quantentheorie - Studenten In Den Neunzigern Die Neokonservativen - Schwarzbuch Soziale Arbeit - Essential Hypertension 2 - Hip Biomechanics - Grundriss Der Dermatologie - Perception And Motor Control In Birds - A Practitioners Guide To Prescribing Antiepileptics And Mood Stabilizers For Adults With Intellectual Disabilities - Gatt Negotiations And The Political Economy Of Policy Reform - Kinderradiologie 1 - Current Topics In Contact Dermatitis - Hautkrankheiten Und Syphilis Im Suglings Und Kindesalter - Grundlagen Der Wahrscheinlichkeitsrechnung Und Statistik Sowie Anwendungen Im Operations Research - Powered Flight - Rechtssoziologie - Konfliktbearbeitung Durch Internationale Organisationen - Ejnar Hertzsprung - Zukunft Der Arbeit Und Geschlecht - Partnerwahl Und Heiratsmuster - Anteil Der Konstruktion Und Des Materials An Dem Wirtschaftlichen Ausbau Niederer Wasserkraft-geflle Mit Besonderer Bercksichtigung Der Verhltnisse An Der Ruhr - Algebra Aller Anfang Ist Leicht - Formeln Und Fakten - Das Gedingewesen Im Bergbau - Das Abzahlungsgeschft In Handel Und Industrie Und Seine Finanzierung - Strategic International Marketing - Data Fusion Concepts And Ideas - Stresses In Shells - Mnnerpolitik - Mathematical Modeling For Complex Fluids And Flows - Psychische Strungen Im Kindes- Und Jugendalter - Magnetische Induktion In Eisen Und Verwandten Metallen - Mathematische Tafeln Markscheider Und Bergingenieure Sowie Zum Gebrauche Bergschulen - Praktische Informatik - Eine Einhrung - Politik Besser Verstehen - Ajcc Cancer Staging Atlas - Einhrung In Die Psychotherapie Medizinstudierende Und „rzte - Variational And Finite Element Methods - Advances In Metal Processing - Augenrztliche Eingriffe - Beratungslehrer - Schriftspracherwerb - Active Contours - Die Physikalischen Und Chemischen Grundlagen Der Glasfabrikation - Lectins And Glycoconjugates In Oncology - Planung In Der Krise - Elektrische Kraftbertragung Und Kraftverteilung - Didaktische Probleme Der Elementaren Algebra - Talsperren In Deutschland - Lehrbuch Der Topographischen Anatomie - Psychiatry And Philosophy - Kulturelle Befangenheit Und Anpassung - Die Gemeinntzige Gmbh - Principles Of Statistical Radiophysics 4 - Finanzmathematik - Corporate Style - Lehrbuch Der Militrhygiene - Anleger-check Edelmetall-investments - Satellite Communications - Entfesselte Wissenschaft - Atlas Der Experimentellen Kaninchensyphilis - Germinal Centers In Immune Responses - Bilanzierung Von Finanzinstrumenten - Politik Und Regieren In Bayern - Hydrographie - Redaktionsmanagement - Kinder- Und Jugendarmut In Deutschland - Konkrete Soziologie - Eigenkapitalfinanzierung - Technischer Lehrgang Hydraulik - Atlas Zur Spurenkunde Der Elektrizitt - Butter · Kse Milchprparate Und Nebenprodukte - Arzneimittel-atlas 2011 - Demokratie Und Internet - Grundkurs C++ In Beispielen - Computerstile - Lehrbuch Der Mathematik Wirtschaftswissenschaften - Die Wirtschaftliche Lage Von Kanada - Die Missbildungen Und Anomalien Der Nase Und Des Nasenrachenraumes - Soziale Arbeit Den Aktivierenden Staat - Graph Data Model - Mr Mammography Mrm - Die Bestimmung Der Wasserstoffionenkonzentration Von Flssigkeiten - Investment Fonds - Gestational Diabetes - Interviews In Der Recherche - Repertorium Der Theorie Der Differentialgleichungen - Sozialer Raum Und Soziale Arbeit - Einhrung In Die Moderne Kinderheilkunde Ein Lehrbuch Studierende Und „rzte - Food Webs - Wireless-netzwerke Den Nahbereich - Key Account Management - Die Deckung Der Valutarisiken Im Warenhandel Und Die Buchhrung Ber Valutatransaktionen - Metabolic Reactions In The Nervous System - Cosmic Plasma Physics - Adsorption Of Organic Compounds On Electrodes - Zugang Zu Internet Und Digitalem Fernsehen - Recent Developments In Applied Demand Analysis - Der Bau Des Dieselmotors - Mammo-t - Unvollstndige Akteure - Internationale Whrungsprobleme - Bone Implant Grafting - Jugendarbeit Als Beruf - Medien Und Politischer Prozey - „warum Haben Sie Eigentlich Streit Miteinander - Moderne Soziologische Theorien Und Sozialer Wandel - Advances In General And Cellular Pharmacology - Das Leistungsvermgen Der Wlzlager - Die Virtuelle Gesellschaft Des 21 Jahrhunderts - Die Nachhaltigkeit Von Entwicklungsprojekten - Standards In Pancreatic Surgery - Energetics Of Geological Processes - Bildung Die Einwanderungsgesellschaft - Politikwissenschaft In Der Bundesrepublik Deutschland - Integral Transforms In Geophysics - In Der Sprache Der Tter - Physik Und Chemie Der Grenzflchen - Hauptbegriffe Qualitative Sozialforschung - Urological Emergencies In Clinical Practice - Betriebs- Und Selbstkostenprobleme Der Wollindustrie - Erfindung Und Nachahmung - Metabolic Interconversion Of Enzymes 1973 - Immunoassays In Coagulation Testing - Pr-ausbildung In Deutschland - Handbuch Des Wasserbaues - Jugend Krper Und Geschlecht - Die Us-amerikanische Somaliaintervention 1992-1994 - Unternehmer Ins Netz! - Kultur Und Wirtschaft - Thermodynamics For Chemists Physicists And Engineers - Der Flug Der Tiere - Naturwissenschaftliche Bildung In Deutschland - Sanierung Von Metallbauteilen - Kommutatorkaskaden Und Phasenschieber - Aachener Bausachverstndigentage 2011 - Die Groyen Revolutionen Und Die Kulturen Der Moderne - Augenpraxis Nichtspezialisten - Cardiovascular Diseases And Pregnancy - Die Vorteilhaftigkeit Relativer Anreizschemata Unter Bercksichtigung Der Kollusionsgefahr - Instruktion Durch Text Und Diskurs - Diagnosis And Management Of Melanoma In Clinical Practice - Die Urteilsbildung In Der Psychodiagnostik - Der Lichtelektrische Effekt Und Seine Anwendungen - Menschenkenntnis Hrungskrfte - The Radiotherapy Of Malignant Disease - Managementmaynahmen Gegen Produktpiraterie Und Industriespionage - The Perfect Test - Leadership Branding - Furniere Lagenhlzer Und Tischlerplatten - Grundkurs Web-programmierung - Die Physikalische Komponente Der Pflanzlichen Transpiration - Schlsselwerke Der Postcolonial Studies - Zwischen Anarchie Und Strategie - Lebenslufe Hben Und Drben - Die Arzneimittel-synthese - Krise Und Einkommen - Die Hchste Nerventtigkeit Das Verhalten Von Tieren - Human Physiology - Konstruktion Digitaler Systeme - Jugend-gewalt - Parteijugend In Deutschland - Brgerinformation Durch „neue Medien - Code-wechsel - Heinrich Von Kleist - Frankreich Jahrbuch 2003 - Die Technik Der Psychoanalyse - Differential- Und Integralrechnung - Kunst Und Religion Der Mayavlker - Internationale Professionalitt - Grundlagen Der Geotechnik - Simulation Von Rhrenverstrkern Mit Spice - Analogcomputer In Chemie Und Biologie - Heart And Brain Brain And Heart - Die Taxation Maschineller Anlagen - Erziehung Durch Arbeit - Kinder- Und Jugendkriminalitt - Der Alltgliche Kampf In Organisationen - Grundriss Der Suglings≈ Und Kleinkinderkunde - Aids - Die Politische Soziologie C Wright Mills - Signale Und Systeme Verstehen Und Vertiefen - Zukunft Der Demokratie In Deutschland - Die Biologischen Grundlagen Der Sekundren Geschlechtscharaktere - Informationslogistik - 100 Minuten Den Kompetenten Auftritt - Long-term Studies In Ecology - Institutionelle Herausforderungen Im Neuen Europa - Unternehmensbewertung In Osteuropa - Das Kriegsgeschehen 2002 - The Future Of Transportation And Communication - Die Kommanditgesellschaft Auf Aktien Kgaa - Fernseh-programme In Deutschland - Rechnerarchitektur Einhrung Und Grundlagen - Personalbeurteilung - Die Selbstttige Regelung - Die Abderhaldensche Reaktion - Grundlagen Der Gynkologischen Ausbildung - Compressive Optic Nerve Lesions At The Optic Canal - Der Staat Als Zufall Und Als Notwendigkeit - Parallele Digitale Optische Recheneinheiten - Neurogenetik - Ingenieure - Electron Microscopic Atlas Of Lymph Node Cytology And Pathology - Eine Blhende Psychiatrie In Gefahr - Lebenserinnerungen - Die Verunreinigung Der Gewsser Deren Schdliche Folgen Sowie Die Reinigung Von Trink- Und Schmutzwasser - Lern- Und Leistungsmotivation - Parteienwettbewerb In Den Deutschen Bundeslndern - Manual Der Osteosynthese - 300 Jahre Deutsch-japanische Beziehungen In Der Medizin - Die Frderung Von Massengtern - Nachhaltiges Vertriebscontrolling Elektrotechniker - Interaktives Fernsehen - Transosseous Osteosynthesis - Staatsoberhupter In Westlichen Demokratien - Standardisierung Der Bildung - Astronomische Miniaturen - Arbeitsmethoden Der Thermodynamik - Pharmazeutische Informationssysteme - Social Branding - Einhrung In Die Allgemeine Und Spezielle Vererbungspathologie Des Menschen - Sexuelle Traumatisierung Und Ihre Folgen - Hre Dich Selbst! - Unternehmensethik Konkret - Pretreatment In Chemical Water And Wastewater Treatment - Rechnerverbindungsstrukturen - Betriebsverrechnung In Der Chemischen Groyindustrie - Organisation Strukturwandel Und Arbeitsmarktmobilitt - Bildungs- Und Erziehungskatastrophe - Vieweg Handbuch Kraftfahrzeugtechnik - Bone Metastases - Journalistische Kultur - Himmelsfotografie Mit Schmidt-teleskopen - Medien Und Die Soziale Konstruktion Von Zeit - Der Neue Verkaufsmanager - Freiwilligenagenturen In Deutschland - Wieder Das Fusionsfieber - Elektronische Demokratie Und Virtuelles Regieren - Komplexittsmanagement - Entstehung Von Kooperationsfhigkeit - Dokumentation In Der Mess- Und Prftechnik - Prfungstrainer Mathematik - Das Rot-grne Projekt - Mutter + Vater = Eltern - Mittheilungen Ber Den Niederrheinisch-westflischen Steinkohlen-bergbau - Maschinenuntersuchungen - Management In A Dynamic Environment - Metal Ions In Neurological Systems - Neurochirurgische Operationen - Allgemeine Pharmakologie - European Data Protection In Good Health - Physik Mit Dem Pc - Lumbar Spinal Stenosis - Handbook Of Children With Special Health Care Needs - „die Unsichtbaren Dritten - Handbuch Jugendkriminalitt - Medienethik Und Die "anderen" - The Lec Rat - Lebenshrung Und Gesellschaft - Analytische Und Projektive Geometrie Die Computer-graphik - Chronische Conjunctivitis Trockenes Auge - Beginning Windows Phone App Development - Technologische Grundprozesse Der Vakuumelektronik - Atlas Normaler Rntgenbilder Des Schdels Atlas Of Normal Radiographs Of The Skull Atlas De Radiographies Normales Du Cr¢ne Atlas De Radiografias Normales Del Cr¡neo - Tunnelbau - Einwanderungsland Hessen - How Should Elderly Hypertensive Patients Be Treated - Wieder Den Konomischen Unsinn! - Improved Non-steroid Anti-inflammatory Drugs Cox-2 Enzyme Inhibitors - Professionell Telefonieren - Kaiser Wilhelm Sein Leben Und Seine Zeit 17971888 - Kinderreiche Mtter - Handbuch Der Astrophysik - Zukunft Einer Frauengerechten Gesundheitsversorgung In Nrw - Das Sprengluftverfahren - Bakteriologische Diagnostik - Die Vertragsmssige Doppelwhrung - „ich Wnschte Ich Wre Glubig Glaub Ich - Telepublishing - Supramolekulare Chemie - Elektrische Starkstromanlagen Maschinen Apparate Schaltungen Betrieb - Vorfuychirurgie - Chemische Elementarprozesse - Phonosurgery - Dynamics During Spectroscopic Transitions - Future Value - Mathematische Algorithmen Im Unterricht - Qualittsmanagement In Der Assekuranz - Pro Ios 5 Augmented Reality - Die Bndel-nagelung Experimentelle Und Klinische Studie Ber Eine Neuartige Methode Der Markraum-schienung Langer Rhrenknochen - Platow Prognose 2009 - Qualifizierte Facharbeit Im Spannungsfeld Von Flexibilitt Und Stabilitt - Subverting Borders - Aufbereitung Metallischer Sekundrrohstoffe - Chirurgische Knochen- Und Gelenkerkrankungen - Handbuch Werbeforschung - Kinder- Und Jugendarbeit Als Bildungsprojekt - Derivate Im Risikomanagement Von Fuyballunternehmen - Marktwirtschaften Unter Dem Druck Globalisierter Finanzmrkte - Die Apparatfrberei Der Baumwolle Und Wolle Unter Bercksichtigung Der Wasserreinigung Und Der Apparatbleiche Der Baumwolle - Ergebnisse Der Chirurgie Und Orthopdie - Cc++ Werkzeugkasten - Schul- Und Unterrichtsreform Durch Ergebnisorientierte Steuerung - Excel Fortgeschrittene Am Beispiel Der Darlehenskalkulation Und Investitionsrechnung - Das Einmaleins Der Siedlung - Arbeit Gegen Armut - Treatment With Gallopamil - Krankheit Konflikt Und Soziale Kontrolle - Festband Zum 70 Geburtstag Von Rolf Nevanlinna - Java Ist Eine Sprache - Advances In Nitrate Therapy - Fit In Schlips Und Kragen - Lehrbuch Der Kinderkrankheiten - Second Quantized Approach To Quantum Chemistry - Interventionsforschung Band 1 - Das Deutsche Gemeinderatsmitglied - Anleitung Die Polizeilichen Revisionen Der Metzgerte Vom 22 Juli 1925 - Armut In Der Stadt - Grundfragen Der Theorie Politischer Institutionen - Regieren In Der Bundesrepublik Iv - Kompendium Der Balneologie Und Kurortmedizin - Regionale Governance Des Funktionswandels Von Flughfen - Neurocritical Care - Konsumentenheterogenitt Und Struktur Des Auyenhandels - Erddrucktheorien - Frauen Und Das Institutionelle Europa - Wozu Braucht Man Demokratie - Allein Unter Frauen - Beton Anregungen Zur Verbesserung Des Materials - Allgemeine Wirtschaftslehre Broberufe - Schwingungen - „ertragt Mich Dass Ich Rede - Nonconventional Yeasts In Biotechnology - Einstieg In Die Wirtschaftsmathematik - Animal Lectins Form Function And Clinical Applications - Die Induktive Wrmebehandlung - Elektronenmikroskopische Hmatologie - Die Aussichten Von Zwanglaufkesseln - Fraktionen Im Deutschen Bundestag 1949 1997 - Dictionnaire ‰conomique Wirtschaftswrterbuch - Neuroradiology - Gentrification - Nherungsversuche Jugend 81 - Wissensmanagement In It-unternehmensberatungen - Walsh-funktionen Ingenieure Und Naturwissenschaftler - –ffentlich-private Partnerschaften - Grundzge Der Zhlertechnik - Geometrische Optik - Environmental Hygiene Iii - Ipod Touch Made Simple Ios 5 Edition - Theories Of Neurosis - Chinese Drugs Of Plant Origin - Einhrung In Die Digitale Signalverarbeitung - Versuch Einer Ontologie Der Persnlichkeit - Die Montage Von Stahlbauten - Die Gewerblichen Und Industriellen Abwsser - Pulstechnik - Reformen In Deutschland - Die Kpenfarbstoffe Und Ihre Verwendung In Der Frberei Und Im Zeugdruck - Nahost Jahrbuch 2003 - Bilanzierung Von Pensionsverpflichtungen - Die Grundlagen Der Hochfrequenztechnik - Medizinische Kommunikation - Der Herzanfall - Bilanzanalyse Und Bilanzkritik - Differenzierung Und Integration Der Modernen Gesellschaft - Qualitative Forschung In Der Sozialpdagogik - Aseismischer Anlagenbau - Soziale Konstruktionen - The Art Of Accompanying And Coaching - Controller-anforderungsprofile - The Human Sense Of Smell - Das Politische System Der Niederlande - Grundlagen Der Arbeitsorganisation Im Betriebe Mit Besonderer Bercksichtigung Der Verkehrstechnik - Thermische Solaranlagen - The Juxtaglomerular Apparatus - Das Neue Deutsche Regierungssystem - Nationale Identitt Und Staatsbrgerschaft In Den Usa - Globales Lernen Und Lokale Agenda 21 - Wirtschaftsmathematik Leicht Gemacht - Asymptotic Modeling Of Atmospheric Flows - Die Grundlagen Der Verkehrswirtschaft - Handbuch Des Strayenbaus - Theorie Der Informationsbertragung - Riemanns Geometrische Ideen Ihre Auswirkung Und Ihre Verknpfung Mit Der Gruppentheorie - Organisation Im Bankbetrieb - Lehrbuch Der Arithmetik Und Algebra Hhere Lehranstalten Bearbeitet - Internationale Umweltregime - Akquisition Auftrag Profit - Selbst- Und Fremdzuschreibungen Im Kontext Von Europa - Grenzberschreitungen - Die Strukturierung Konomischer Entscheidungsmodelle - Grundbegriffe Der Ganztagsbildung - Die Europische Union Nach Der Osterweiterung - Handbuch Elternbildung - Suggestion And Suggestibility - Materia Medica Of New And Old Homeopathic Medicines - Sozialpolitik - Ultraschalldiagnostik 86 - Total Knee Replacement - Surgery Of The Stomach - Festverzinsliche Wertpapiere - Aus Der Frhzeit Der Eisenbahnen - Elastizitt Und Festigkeit - Grundzge Der Botanik Pharmazeuten - –konomie Und Glck - Professionelles Zeitmanagement - Untersttzung Der Unternehmensentwicklung Junger Wachstumsorientierter Technologieunternehmen Durchventure Capital-gesellschaften In Der Betreuungsphase - Homogenization Of Differential Operators And Integral Functionals - Gefhrdete Jugendliche - Stufen Zur Akademisierung - Politische Kultur In Stdtischen Rumen Parteien Auf Der Suche Nach Whlern Und Vertrauen - Einhrung In Die Physik - Imaging Of Brain Metabolism Spine And Cord Interventional Neuroradiology Free Communications - Erfolgreich Akquirieren - Marine Geochemistry - Religion Ohne Institution - Die Textilfasern - The Mathematical Foundation Of Structural Mechanics - Tierische Sozialarbeit - Theorien Und Methoden In Den Sozialwissenschaften - Die Ernhrung Des Menschen Mit Besonderer Bercksicht Gung Der Ernhrung Bei Leibesbungen - Nichtlineare Stabstatik - Registrierinstrumente - Die Brennstoffe - Technologie - Fundamentals Of Food Process Engineering - Die Stromversorgung Von Fernmelde-anlagen - Anleitung Zum Mischen Von Branntweinen Nach Maay Und Gewicht - Politische Soziologie - The Training Courses Of Urological Laparoscopy - Die Verwaltung Der –ffentlichen Arbeiten In Preussen 1890 Bis 1900 - Mobile Gesellschaft Und Soziale Arbeit - Zehn Blatt Der Schriftproben 17 - Structure And Function Of Major And Minor Small Nuclear Ribonucleoprotein Particles - Parallele Numerik - Zeitaufwand Tafeln Die Kalkulation Von Strayen-und Tiefbauarbeiten - Die Wissenschaftliche Und Angewandte Photographie - Die Inventur - Artificial Liver Support - Morphology And Function In Mri - Medientraining Manager - Atomic And Nuclear Clusters - Groyeltern In Europa - Dienstleistungsqualitt - Die Chirurgie Des Mensurbodens - Kartelle Als Produktionsfrderer - Applications Of Fractals And Chaos - Sensory Evaluation Of Food - Absolute Thermische Daten Und Gleichgewichtskonstante - Alltagsrationalitt In Der Nachrichtenrezeption - Organic Geochemistry - Stahlbau Und Baustatik - Der Verbrennungsvorgang Im Gas- Und Vergaser-motor - Gegenwrtige Zuknfte - Kompendium Der Augenheilkunde - Baukultur Wohnkultur –kologie - Recent Developments In Micromechanics - Wie Aus Wildnis Gesellschaft Wird - Frauen Im Militr - Erbbiologie Und Erbpathologie Nervser Und Psychischer Ƶustnde Und Funktionen - Handbuch Der Public Relations - Sinnstiftung Als Beruf - Der Vestibulre Nystagmus Und Seine Bedeutung Die Neurologische Und Psychiatrische Diagnostik - Sprachentwicklung Und Interaktion - Die Vereinfachte Berechnung Biegsamer Platten - Brain And Behavior In Child Psychiatry - Performance Based Logistics - Chemodynamics And Environmental Modeling - Werbung Mode Und Design - Handelsmarketing - Building A Data Warehouse - Arbeitsmrkte Und Sozialstrukturen In Europa - Journalismusjournalismus - Der Werdende Mensch - Der Absatz In Der Chemischen Industrie - Neubewertung Der Familienarbeit In Der Sozialpolitik - Orthopdische Erkrankungen Des Kindesalters - Wirtschafts- Und Bevlkerungsstatistik - Entterritoriale Politik - Schutz Gegen Berhrungsspannungen - Elektrotechnik Im Maschinenbau - Die Grundlagen Der Nomographie - Handbuch Der Deutschen Arzneipflanzen - Temperaturmessung - Gasdynamik Der Verbrennung - Guide To Web Development With Java - Kinderlhmungen - Forschung Und Handeln - Ursprnge Der Zweiten Republik - Cerebral Ischemia And Dementia - Reformprozesse Im Bildungswesen - The Sodium Pump - Demokratische Streitkultur - Prozeyorientierte Unternehmensorganisation - A Safer Death - Customer Banking - Der Austausch Von Betriebserfahrungen - Zwischen Zwang Und Freiwilligkeit - Rechtsquellen Zum Steuerstandort Liechtenstein - Klinische Hypnose - Verhandeln Und Argumentieren - Atlas Of Scrotal Ultrasound - Finite-elemente-methode - Manfredo P Do Carmo Selected Papers - Alternierende Telearbeit - Functional Integration - Progress In Pacific Polymer Science - Fibrinklebung In Der Herz- Gefy- Und Thoraxchirurgie - Fractures Of The Acetabulum - Normativitt In Der Kommunikationswissenschaft - Klinik Der Darmkrankheiten - Model Order Reduction Techniques With Applications In Electrical Engineering - Proceedings Of The Fourth Conference On Origins Of Life - Einhrung In Die Analysis - Die Auyenpolitik Kanadas - Generationen Eines Jahrhunderts - Hoai-kommentar - Die Angepassten Provokateure - Umweltgerechte Verkehrskonzepte - Scheitern - Carbon Capture - Service Ist Sexy! - Autonomes Handeln Als Personale Und Gesellschaftliche Aufgabe - Loudspeaker Handbook - Chancengleichheit Auf Japanisch - Global Problems And Common Security - Die Volkspartei - Denken Und Handeln An Finanzmrkten - Methoden Der Diagnostischen Hmatologie - Planung Und Optimierung Von Rechnernetzen - Die Energiefrage - Cordless Telecommunications In Europe - Aids Und Die Vorstadien - Konstanten Der Atomphysik - Die Unsichtbare Hand Im Unternehmen - Parlamentarismus Im Zeitalter Der Europischen Integration - Plastic Surgery Of Head And Neck - Kreativitt Und Form - Die Wischendampfverwertung In Entwicklung Theorie Und Wirtschaftlichkeit - Information Strategy Design And Practices - Best Services - Das Politische System Ungarns - Doing Modernity - Doing Religion - Familientherapie Und Familienforschung - Perspectives In Turbulence Studies - Kompetenzentwicklung Im Wandel - Transductions And Context-free Languages - Brger Oder Bettler - Von Adenauer Zu Schrder Der Kampf Um Stimmen - Elektrische Meygerte Und Meyeinrichtungen - Isdn Und Lokale Netze - Soziologie In Deutschland - Funktionelle Elektrostimulation - Remote Service Technology Perception And Its Impact On Customer-provider Relationships - Selenium In Biology And Medicine - Taking Your Iphone 4s To The Max - Zuverlssige Numerische Analyse Linearer Regelungssysteme - Jahresbericht Ber Die Beobachtungs-ergebnisse - Handbuch Informationsmanagement - Schutz Als Neue Norm In Den Internationalen Beziehungen - Calcium Antagonists - Interdisziplinre Risikoforschung - Integriertes Geschftsprozessmanagement - Linguistik Im Internet - Neues Europa Alte Eu - Ciprofloxacin Iv - Soziale Lagen Im œbergang - Differentialgeometrie Und Homogene Rume - Lokale Publizistik - 3d Geoscience Modeling - Der Effekt Der Systemuntersttzung Auf Die Politische Partizipation - Models And Measurement Of Welfare And Inequality - –kologisches Entwicklungspotential Der Bergbaufolgelandschaften Im Niederlausitzer Braunkohlerevier - Cerebral Ischemia And Calcium - Statistical And Computational Techniques In Manufacturing - Dictionary Of Soil Bioengineering Wrterbuch Ingenieurbiologie - Geboren 1964 Und 1971 - Die Gleichheit Der Geschlechter Und Die Wirklichkeit Des Rechts - Die Geschichtliche Entwicklung Der Hochspannungs-schalttechnik - Bevlkerungsentwicklung In Ostdeutschland - Soziologische Aufklrung Als Moralische Passion Pierre Bourdieu - Jugendtrends In Ostdeutschland Bildung Freizeit Politik Risiken - Umweltschutz Als Sozialer Prozey - Medienethik Und Medienwirkungsforschung - Bilanztheorie In Der Us-amerikanischen Und Internationalen Standardsetzung - Elektrische Antriebe In Der Zellstoff- Und Papierindustrie - Zwischen Pragmatischer Und Moralischer Ordnung - Lohmeyer Baustatik 1 - Krpermass-studien An Kindern - Stoffstromanalysen - Bildung Nachhaltige Entwicklung - Psychosynergetik - Religion Kultur Und Politik Im Vorderen Orient - 3d-kino - European Perspectives On Taiwan - Perspektive Und Axonometrie - Systems Theory And Biology - Jahrbuch Psychodrama Psychosoziale Praxis And Gesellschaftspolitik 1991 - Zwerchfellpathologie Im Rntgenbild - Multimedia-kommunikation - Informierte Grndungsfrderung - Handbook Of Parathyroid Diseases - Grundlagen Der Organisation - Heterogene Gleichgewichte - Glck Und Zufriedenheit - Therapeutic Hemorheology - Clusters In Automotive And Information And Communication Technology - Auyenpolitik Und Auyenwirtschaft Der Volksrepublik China - Karst Hydrology - Karriere Machen Der Weg In Die Unternehmensberatung - Depressive Illness - Cardiology For The Primary Care Physician - Der Zahnarzt In Der Karikatur - Fracture Mechanics - Integrationspdagogik Und Geschlecht - Die Hebezeuge Theorie Und Kritik Ausgehrter Konstruktionen Mit Besonderer Bercksichtigung Der Elektrischen Anlagen Ein Handbuch Ingenieure Techniker Und Studierende - Adjustment Of Schizophrenics In The Community - Gehirn Und Auge - Cfd Handel - Die Milz The Spleen - Kleben - Erfolgreich Und Fehlerfrei - Plant Growth Substances 1988 - Zweckrationalitt Und Strafrecht - Technische Anwendungen Des Lasers - Stoffaufnahme · Stoffwanderung Wachstum Und Bewegungen - The First Twelve Weeks Of Gestation - Efficiency Institutions And Economic Policy - Elementares Lehrbuch Der Sozialpsychologie - Lehrbuch Der Allgemeinen Tierzucht - Entwicklungs-geschichte Der Augenrztlichen Kunst-ausdrcke - Intracranial And Intralabyrinthine Fluids - High Energy Spin Physics - Die Lebensstilgesellschaft - Magnetic Recording Handbook - An Atlas Of Axial Transverse Tomography And Its Clinical Application - Diskriminierung - Groykessel-feuerungen - Das Skizzieren Ohne Und Nach Modell Maschinenbauer - Europische Integration - Optimale Produktions- Und Absatzplanung - Langeweile œberdruy Und Lebenssinn - Handbuch Geschlechterforschung Und Fachdidaktik - Die Elektrogymnastik - Aerodynamik Der Stumpfen Krper - Lehrbuch Der Massage - Die Kausalitt Des Psychischen Prozesses Und Der Unbewussten Aktionsregulationen - Die Bundesrepublik In Den Siebziger Jahren - Technikkritik In Der Moderne - Engineering Tables And Data - Cerebral Ischemia And Basic Mechanisms - Der Ursprung Des Zahlbegriffs - Brownian Motion And Diffusion - Lehmbau Regeln - Endstation Amerika - Die Dynamik Sozialer Und Sprachlicher Netzwerke - Web-programmierung - Lexikon Der Fertigungsleittechnik - Computational Nuclear Physics 1 - Kritik Der Lebenswelt - Elemente Der Neurologie - Fernsehen Als Mythos - Freche Verse Physikalisch - Rituale Der Transformation - Herausforderung Terrorismus - Gabler Bank Lexikon - Felix Hausdorff - Gesammelte Werke Band Ia - Phraseologie In Der Politischen Rede - Practical Sharepoint 2010 Information Architecture - Reoperations In Cardiac Surgery - Die Zentrifugalpumpen - Die Charta Der Grundrechte Der Europischen Union - Ressourcenorientiert Arbeiten - Sprung In Die Selbstndigkeit - Die Befragung Im Kontext Von Raum Zeit Und Befindlichkeit - Einschwingvorgnge Gegenkopplung Stabilitt - Familie In Der Gesellschaft - Mechanik Auf Dem Bildschirm Mit Dem C64 - Gummifreie Isolierstoffe - Lehrbuch Der Physiologie In Zusammenhngenden Einzeldarstellungen - Kostenrechnung 1 - œberbetriebliche Vernetzung Im Handel - Der Medien-prozey - Die Selbstbeobachtungsfalle - Grundlagen Der Cmos-technologie - Pharmakotherapie Und Alter - Eingriffverhltnisse Der Schneckengetriebe Mit Evolventen- Und Cykloidenverzahnung Und Ihr Einfluss Auf Die Lebensdauer Der Triebwerke - Physikalische Metallkunde - Die Forstlichen Verhltnisse Preuyens - Die Diagnose Des Kleinen Magenkrebses - Advanced Robotics 1989 - Methoden Und Architekturen Der Softwaretechnik - Regionale Akteursnetzwerke - Hepatobiliary Diseases - Lehrbuch Der Forsteinrichtung Mit Besonderer Bercksichtigung Der Zuwachsgesetze Der Waldbume - Lohmeyer Stahlbetonbau - Visual Basic Technische Anwendungen - Hypersonic Flows For Reentry Problems - Industrielle Keramik - Manual Of Neonatal Respiratory Care - Broken Markets - Landespolitik Im Europischen Haus - Wave Propagation In Dissipative Materials - Hirnverletzungen - Sexual Reproduction In Higher Plants - Beginning Ios Storyboarding - The Purchasing Chessboard - Cause Related Marketing - Einhrung In Die Entwicklungsphysiologie Des Kindes - Wirkung Nach Plan - Die Ironie Gottes - Technische Berichte - Die Familienpolitik Muss Neue Wege Gehen! - Die Isolierstoffe Der Elektrotechnik - Die Mercerisierungsverfahren - Chemisch-technische Untersuchungsmethoden - Jugendtypen - Die Erkennung Der Feld- Wiesen- Und Weide-ungrser Unter Bercksichtigung Ihrer Bltenstnde - Grundlegung Der Lehre Vom Sozialen Verband - Intervention Kultur - Politische Bildung In Der Bundesrepublik - Nahost Jahrbuch 1988 - The Protistan Cell Surface - Medienwirkungen Das Dynamisch-transaktionale Modell - Konstruktive Geometrie In Der Technik - Moderne Vakuumelektronik - Berechnung Von Behltern Nach Neueren Analytischen Und Graphischen Methoden - Opportunities And Constraints Of Parallel Computing - Problems In Stellar Atmospheres And Envelopes - Thoracic Surgery - Growth Factors Differentiation Factors And Cytokines - Mobilmachung Im Mittelstand - Die Behandlung Der Geschwlste Nach Dem Gegenwrtigen Stande Und Den Ergebnissen Der Experimentellen Forschung - Stadt Und Arbeitslosigkeit - Lernkompetenzen An Hochschulen Frdern - Betoninstandsetzung - Soziologischer Funktionalismus - Betriebswirtschaftslehre Und Recht - Mutter Tochter Anne Kiz - Physik Mediziner - Erinnern Und Vergessen - Lehrbuch Der Kriegschirurgie - Das Wirtschaftssystem Fords - Testen Von Informationssystemen - Instinkt Und Erfahrung - Die Zerspanbarkeit Der Metallischen Und Nichtmetallischen Werkstoffe - Politisches Wissen Ber Die Europische Union - Pacific Crystal Centre For Science Mathematics And Technology Literacy Lessons Learned - Buchhrung Und Jahresabschluy - Running Ipv6 - Genetics Of Influenza Viruses - Grundriss Soziale Arbeit - Lehrbuch Der Chirurgie Und Orthopdie Des Kindesalters - Geschlecht Ethnizitt Klasse - Transitionen In Der Bildungsbiographie - European Populations - Erweiterte Datenanalyse Mit Spss - Capillary Electrophoresis - Coronary Circulation - Formale Semantik Und Natrliche Sprache - Radionuclide - Mobilisierung Alle - Modern Aspects Of Electrochemistry - Emergencies In General Practice - Co2 Laser Surgery - Stabilitt Und Transformation Politischer Systeme - Kommentar Zur Vorlufigen Landarbeitsordnung Vom 24 Januar 1919 Nebst Einem Abdruck Der Bestimmungen Ber Die Anwerbung Und Beschftigung Auslndischer Arbeiter - Die Regulationsfunktion Des Menschlichen Labyrinthes Und Die Zusammenhnge Mit Verwandten Funktionen - Pro Apache Ant - Java-grundkurs Wirtschaftsinformatiker - Gynkologie Und Geburtshilfe 1992 - œberflle Und Wehre - Kundennutzen Die Anwendung Im Verkaufsgesprch - Percutaneous Lumbar Discectomy - Grundbau Dynamik - Das Subdurale Hmatom - Hilfsbuch Betriebsberechnungen - Verbandliche Interessenvertretung Und Mitgestaltung In Den Mittel- Und Osteuropischen Transformationsstaaten - Pacific Cooperation From The Japanese And The German Viewpoint - Gynkologische Operationen - Turbulent Shear Flows 7 - Metamorphosen Der Technik - Die Arbeitszeitermittlung Der Verzahnungsarbeiten - Grundlagen Der Doppelten Buchhrung - Recurrent Mood Disorders - Zeigt Mir Was Ihr Knnt! - Die Wow-prsentation - Gendered Profession - Friedrich Engels Schriften Der Frhzeit - Mobile Business - Starthilfe Pharmazie - Funktionen Einer Vernderlichen - Atlas Der Morphologischen Plazentadiagnostik - Einsteins Vision - Tunnel Und Verdeckte Kanle Im Netz - Die Technik Der Blutgruppenuntersuchung Kliniker Und Gerichtsrzte - Professionelle Vertriebspower Im Maschinen- Und Anlagenbau - Variationsrechnung - Current Problems In Ptca - Online-medien Als Quellen Politischer Information - Septischer Abort Und Bakterieller Schock - Handbuch Des Revolverdrehers - Energieversorgung Elektrischer Bahnen - The Berlin Creative Industries - Postmoderne Kultur - Blade Runner Matrix Und Avatare - Grundriy Der Gesamten Praktischen Medizin - Exkursionsbuch Zum Bestimmen Der Vgel In Freier Natur Nach Ihrem Lebensraum Geordnet Laien Und Fachleute - Die Operative Technik Des Tierexperimentes - Gear Motor Handbook - Lehrbuch Der Herzkrankheiten - Politik Diesseits Der Macht - Risikomanagement In Projekten - Foundations Of Economic Development - Wirtschaftsspionage Und Intelligence Gathering - Fabrikschulen - Die Freien Hauttransplantationen - Durch Die Weiye Wste - Progress In Pacific Polymer Science 3 - Das Unternehmen Als Institution - Gestaltung Regionaler Politik - „arbeiterklasse Oder Arbeitnehmer - Das Kleine Nein Im Groyen Ja - Grundwissen Mathematik Ingenieure - Automotive Simulation 91 - Die Gedanken Werden Handgreiflich - Resistenz Von Kulturpflanzen Gegen Tierische Schaderreger - Leitfaden Der Humangenetik - Lsungsheft Rechnen Bankkaufleute - Perinatal Events And Brain Damage In Surviving Children - Parteien Im Wandel - Grundzge Der Physik - Alternative Investments Verstndlich Verkaufen - Investitionsgtermarketing - Kurzgefasstes Lehrbuch Der Gerichtlichen Psychiatrie Mediziner Und Juristen - Stochastic Structural Dynamics 1 - Trauma Aids - Englands Zivilprozey - Chemie Des Bauwesens - Environmental Hygiene - Institutionelle Erneuerungsfhigkeit Der Forschung - Haustechnik Im Wohnungsbau - Biomedizinische Technik 4 - Verfassungsgebung Und Systemwechsel - Grundzge Der Rntgendiagnostik - Ausgewhlte Chemische Untersuchungsmethoden Die Stahl- Und Eisenindustrie - Asymptotics For Associated Random Variables - Das Framing Von Issues In Medien Und Politik - Advances In Human Genetics 15 - Die Rntgentechnik In Diagnostik Und Therapie - Organisieren Und Organisationen Verstehen - Handbook Of Evidence-based Critical Care - Pneumologische Umweltmedizin - Die Kathodenstrahlrhre Und Ihre Anwendung In Der Schwachstromtechnik - Musikmobile Kulturarbeit Und Populre Musik - Risiko Kreditklemme - Migration Im Wettbewerbsstaat - Beitrge Zur Psychodynamik Endogener Psychosen - Die Geschichte Der Kinderheilkunde - Ein Vorschlag Zur Eherechtsreform - Handbuch Der Katalyse - Die Kretinische Entartung - Moleklkraftkonstanten - Menschenkenntnis Verkufer - Radiative Corrections For E+e- Collisions - Crystal Pulling From The Melt - Wohlfahrtspolitik Und Globalisierung - Kranbahntrger Aus Walzprofilen - Metallurgische Elektrochemie - Einhrung In Die Empirische Sozialforschung - Kleines Fachbuch Der Kakaoerzeugnisse - Mediatisierte Welten - Fachkommentar Bm„e-go - Einhrung In Die Systemtheorie - Die Tonuskrankheiten Des Herzens Und Der Gefsse - Intestinal Anisakiasis In Japan - Comprehensive Lipid Testing And Management - Handbuch Der Gieyerei-technik - Entwerfen Und Herstellen - Die Neuropathologischen Syndrome - Management Im Ffentlichen Sektor - Die Elliptischen Funktionen Von Jacobi - Fertigungsautomatisierung - Nuclear Magnetic Resonance Spectroscopy Of Cement-based Materials - Kurzer Leitfaden Der Bergbaukunde - Dokumentationsverfahren In Der Herzchirurgie - Professionelle Verkaufsprsentation - Soziologie Des Fremden - Vascular Imaging By Color Doppler And Magnetic Resonance - 50 Jahre Kongress Innere Medizin 18821932 - Bericht œber Den Leobener Bergmannstag - New Advances In Histamine Research - Verstehen Im Unterricht - Parteien In Der Brgergesellschaft - Einhrung In Die Feinstruktur Von Zellen Und Geweben - Geowissenschaften Und Umwelt - Die Akropolis Von Athen - Kenntnis Der Wasch- Bleich- Und Appreturmittel - Die Art Der Abfindung Bei Der Ablsung Von Forstservituten - Gesprchsanalyse Und Dokumentarische Methode - Pedophilia - Interaktive Systeme - Das Harz Der Nadelhlzer Seine Entstehung Vertheilung Bedeutung Und Gewinnung Forstmnner Botaniker Und Techniker - Unartikulierte Krper - Der Elektrische Heiywasserspeicher - Ordnungstheorie Und Ordnungspolitik - Kunst Und Religion Der Mayavlker Ii - Alternativer Umgang Mit Alternativen - Einhrung In Die Mathematik Studenten Der Wirtschaftswissenschaften - Lehrbuch Der Hypnose - Handbuch Des Materialprfungswesens Maschinen- Und Bauingenieure - Die Zweite Lebenshlfte - Bodenschtze Als Biologische Und Politische Faktoren - Energie Die Zukunft - Bcg-therapie Des Oberflchlichen Harnblasenkarzinoms - Die Wrmewirtschaft In Der Zellstoff- Und Papierindustrie - Bibliographie Der Verffentlichungen Ber Den Leichtbau Und Seine Randgebiete Im Deutschen Und Auslndischen Schrifttum Aus Den Jahren 1940 Bis 1954 Bibliography Of Publications On Light Weight Constructions And Related Fields In German And Foreign Literature From 1940 To 1954 - Spreadsheets In Science And Engineering - Tatort Biographie - Praxiswissen Presse- Und –ffentlichkeitsarbeit - Grundlagen Der Bodenmechanik - Black-box Models Of Computation In Cryptology - Berufsziel Journalismus - Arbeitslosengeld-ii-bezug Im œbergang In Das Erwerbsleben - Assembler Griffbereit - Angewandte Statistik Mit Spss - Die Europische Union - Qualitative Perspektiven Des Medienwandels - Erfindung Und Erfinder - Recht Und Tabu - Boolesche Gleichungen - Baufachkunde - Beitrge Zur Photographie Der Blutspektra Unter Bercksichtigung Der Toxikologie Der Ameisensure - Grundkurs Mathematik Ingenieure - Regionalkonomie - Innovatives It-management - Die Klinik Der Beginnenden Tuberkulose Erwachsener - Korrosionstabellen Nichtmetallischer Werkstoffe Geordnet Nach Angreifenden Stoffen - Die Singulre Waffe - Krankheiten Des Herzens Und Der Gefβe - Die Waldbautechnik Im Spessart - Das Wahrheitsproblem Und Die Idee Der Semantik - Allgemeine Und Spezielle Chirurgische Operationslehre - Der Lndliche Raum - Kernreaktortheorie - Medien - Codes - Menschmaschinen - Regelung Der Kraftmaschinen - Pre-mesozoic Geology In The Alps - Precancerous Conditions And Lesions Of The Stomach - Sozialisation In Kologischer Perspektive - Mathematische Juwelen - Wissenschaft In Der Wissensgesellschaft - Shock Waves @ Marseille I - Multi-media Und Marketing - Leitfaden Der Anthropologie - Lehrbuch Der Forstwissenschaft - The Dermal Lymphatic Capillaries - Html5 Games Most Wanted - Vorkurs Informatik - Spanien - Prozessoptimierung Im Rechnungswesen - Mechanik Der Kontinua - Arbeitsbuch Mathematik Ingenieure Band Ii - Anleitung Zur Erkennung Prfung Und Wertbestimmung Der Gebruchlichsten Chemikalien Den Technischen Analytischen Und Pharmaceutischen Gebrauch - Mathematik Volks- Und Betriebswirte - Goethes Naturwissenschaftliches Denken Und Wirken - The Phenomenological Theory Of Linear Viscoelastic Behavior - Funktionalisierung Von Duroplastischen Faserverbundwerkstoffen Durch Hybridgarne - Human Lactation 2 - Power Transducers For Sonics And Ultrasonics - Mikropolitik - Qualittszirkel Erfolgreich Gestalten - Demenz - Perspektiven Mobiler Kommunikation - Journalismus Medien –ffentlichkeit - Grundlagen Der Steuerlehre - Transport- Und Lagerlogistik - Wieviel Demokratie Vertrgt Europa Wieviel Europa Vertrgt Die Demokratie - Organisationskommunikation Und Public Relations - Friseurfachrechnen - Das Interview In Der Psychologie - Foundational Java - Technischer Lehrgang Automatikgetriebe - Analytische Und Konstruktive Differentialgeometrie - Gewalt Durch Gewalt Im Fernsehen - Die Kaufmnnische Erfolgs-rechnung Gewinn- Und Verlust-rechnung - Vom Chaos Zum Konsens - Structure And Change In The Space Economy - Umwelteinstellungen Und Umweltverhalten In Deutschland - Der Glserne Fremde - Gottfried Benn Rainald Goetz - Organ Replacement Therapy Ethics Justice Commerce - Neurophysiologische Untersuchungsmethoden In Der Intensivmedizin - Allgemeine Und Spezielle Physiologie Des Menschenwachstums - Organic Acids In Geological Processes - High Energy Astrophysics - Kompendium Weiterbildung - Bilanzpolitik - Aufgaben Und Fortschritte Des Deutschen Werkzeugmaschinenbaues - Produktgestaltung - Streetball - Flame Hardening - Verfassungspolitik Und Verfassungswandel - Die Hohe Schule Des Total Quality Management - Die Elektrische Futterkonservierung - Compound Semiconductor Device Modelling - Public Marketing - Demographie Und Wohlstand - Individuelle Freiheit Zum Wohle Aller - Aktuelle Therapie Gastrointestinaler Tumoren - –kologische Kompetenz - Heidelberg Congress On Taxing Consumption - Basic And Clinical Research On Renal Cell Carcinoma - Finanzmathematik Einsteiger - Erfolgsausweis Deutscher Aktienkonzerne - Mythen In Der Politik Der Ddr - Diseases Of The Esophagus - Advances In Human Genetics - Psychoanalytic Process Research Strategies - Mathematische Methoden In Der Hochfrequenztechnik - Computer Graphics - Psychology Of Media In Europe - Die Inneren Erkrankungen Im Alter - Die Elektrolytischen Metallniederschlge - Die Technologie Des Maschinentechnikers - Jugend Arbeit Und Identitt - Konfliktlotsen In Dienstleistungsunternehmen - Die Arthrosis Deformans Des Kniegelenkes - Afrika Jahrbuch 2002 - Leitgedanken Einer Neuzeitlichen Werkstoff-forschung - Serviceinnovationen In Industrieunternehmen Erfolgreich Umsetzen - Bauforschung Und Ihr Beitrag Zum Entwurf - Lsungsbuch Zur Einhrung In Die Festigkeitslehre - Handbuch Der Psychosozialen Intervention - Scientific Computing - Maritime Simulation - Aktiv Ins Sekretariat 2000 - Der Harn Sowie Die Brigen Ausscheidungen Und Krperflssigkeiten Von Mensch Und Tier Ihre Untersuchung Und Zusammensetzung In Normalem Und Pathologischem Zustande - Fernsehaneignung Und Alltagsgesprche - Gasturbinen Und Gasturbinenanlagen - Value Theory - Gewerbesteuer - Gewstg - Endocrine Disorders In Thalassemia - Modernisierung Personenorientierter Dienstleistungen - Automobillogistik - Bosch Grundlagen Fahrzeug- Und Motorentechnik - Ferromagnetismus - Proceedings Of The 17th International Conference On The Physics Of Semiconductors - Deutsch-franzsische Geschftsbeziehungen Erfolgreich Managen - Klinik Der Rheumatischen Erkrankungen - Project Management With Dynamic Scheduling - Israel Gesellschaft Im Wandel - Electrochemistry In Organic Synthesis - Illokutionre Krfte - Der Innovative Staat - Chemie Und Chemische Technologie Radioaktiver Stoffe - Analysis Of Energy Efficiency Of Industrial Processes - Annals Of Life Insurance Medicine - Frauen Und Medien - Kriegsschiffbau - Tricad Ms - Die Elektrischen Einrichtungen Den Eigenbedarf Groyer Kraftwerke - Implizite Logiken Des Pdagogischen Blickes - Lernen Und Erfahrung - Erwachsenenbildung In Politischen Umbrchen - Der Mensch Und Die Zeit - Pisa 2000 - Bevlkerungslehre Und Bevlkerungspolitik Vor 1933 - Kultur Als Prozess - Einhrung In Die Klassische Und Intensionale Logik - Verstehen Und Kritik - Medienwissenschaften Und Medienwertung - Der Neue Rechtspopulismus - Erlebnisse Eines Alten Parlamentariers Im Revolutionsjahre 1848 - Urtikaria - Abwasserkonzepte - Die Banken Auf Dem Weg Ins 21 Jahrhundert - Das Biokybernetische Modell - Die Grundlagen Der Relativittstheorie - Krfte In Bewegung - Masterkurs Kostenstellenrechnung Mit Sap - Migration Im Lebensverlauf - Cognitive Screening Instruments - Application Of Structural Systems Reliability Theory - Buchhrung Speditionskaufleute - Epithelial Secretion Of Water And Electrolytes - Privatsache Kind Privatsache Beruf - Automobilelektronik - Theorie Der Sozialen Gruppe - Elektrotechnik Und Witterung - Habitusanalysis 1 - Innovation Without Rand D - Stress And Tension Control 3 - Invertebrate And Fish Tissue Culture - Dickwerden Und Schlankbleiben - Advances In Human Genetics 11 - Die Sprache Des Traumes - Grundlegende Algorithmen - Source And Sediment - Imaging And Technology In Urology - Chemical And Physical Behavior Of Human Hair - Koalitionen In West- Und Osteuropa - Energieversorgung Probleme Und Ressourcen - Theorie Und Technik Der Pulsmodulation - Qualitt Im Theater - Die Person Als Organon In Der Sozialen Arbeit - Personal Im Sozialmanagement - Blutkrankheiten Und Blutdiagnostik - Pediatric Ultrasonography - Die Maschinenzlle In Den Wichtigsten Kulturstaaten Der Welt Nach Dem Stande Vom 1 Januar 1908 - Soziale Hilfe Ein Teilsystem Der Gesellschaft - Parkinson Disease - Management Problems In Health Care - Transformation In Ungarn Und Der Ddr - Julius Springer - Kreativitt Und Improvisation - Selbstbestimmung Als Konstruktion - Direktmarketing Mit Kundendaten Aus Bonusprogrammen - Anleitung Zur Bearbeitung Meteorologischer Beobachtungen Die Klimatologie - „text-tollhaus Bachmann-schtige - Grundlagen Der Informatik Ingenieure - Retinal Detachment Surgery - Legasthenie - Koalitionen Und Koalitionsvereinbarungen - Handbuch Der Kommunalen Sozialpolitik - Vision Und Wandel - Developments In Dairy Chemistry2 - Sandostatin In The Treatment Of Acromegaly - Praktische Duplexsonographie - Die Wechseljahre Der Frau - Anilinschwarz Und Seine Anwendung In Frberei Und Zeugdruck - Pdagogik Der Massenkommunikation - Fundamental Beta - Gold Metallogeny - Die Deutsche Seefischerei - Deutsches Leben Zur Zeit Der Schsischen Kaiser - Nachhaltigkeitscontrolling - Kontinuierliche Und Zeitdiskrete Regelungen - Wege Zum Sozialen - Chemistry And Biology Of Solid Waste - Sedimentary Basins - Geometrische Grundlagen Der Architekturdarstellung - Das Patellofemoralgelenk Beim Knstlichen Kniegelenkersatz - Die Kunst Der Unterredung - Grundlagen Der Eigenspannungen - Die Berechnung Verankerter Hngebrcken - Journalismus Und Wandel - Physik In œbungsaufgaben - Das Wachstum Des Kindes - Zwischen Resignation Und Gewalt - Ministerprsidenten - Demokratietheorie Und Demokratieentwicklung - Abschied Von Der Aufklrung - Jugendliche Maghrebinischer Herkunft Zwischen Stadtpolitik Und Lebenswelt - Dynamics And Interactions Of Galaxies - Die œberhrung Kommunaler Betriebe In Die Form Der Gemischt Wirtschaftlichen Unternehmung - Robotersysteme 3 - Erfolgreich Verkaufen Im Handel - Zirkulre Positionen 2 - Stochastische Optimierung - Das Raum-zeit-problem Bei Kant Und Einstein - Grassroots-campaigning - Fanconi Anemia - Wahrscheinlichkeitstheorie Und Statistik - Einhrung In Eis- Schnee- Und Lawinenmechanik - Us-kongrey Und Deutscher Bundestag - Scientific Visualization Of Physical Phenomena - Elemente Des Vorrichtungsbaues - Analysis - Macromolecules · 1 - Einhrung In Die Programmiersprache C++ - Die Dampfkessel Und Ihr Betrieb - Travel Medicine - Regieren Und Intergouvernementale Beziehungen - Die Wiehler Urgroymutter Und Ihre Verwandtschaft - Politische Bildung In Deutschland - Architektur Zeichnen - Software Engineering - Arbeitsvermgen - Die Werkzeuge Und Arbeitsverfahren Der Pressen - Netzwerkanalyse Netzwerksynthese Und Leitungstheorie - Heilen Forschen Interaktion - Die Mechanischen Beweise Die Bewegung Der Erde - Wachsen Wie Die Sieger - Ditetik Bei Chirurgischen Erkrankungen - Die Hieroglyphen Der Inneren Welt - Clustering-based Support For Software Architecture Restructuring - Management Von Marktpreis- Und Ausfallrisiken - Jahrbuch Verkaufstraining - Benign Prostatic Hyperplasia - A Longitudinal Study Of Adolescent Growth - Komatse Zustnde - In Die Tiefen Des Weltalls - Politische Streitfragen - Relationship Banking - Arteriosclerosis - Ultraschall-diagnostik 89 - Beginning Database Design - Grundkurs Theoretische Physik 6 Statistische Physik - Karriere Machen Vertrieb 2003 - Prostaglandins And The Uterus - Programmieren In Smalltalk Mit Visualworks - Dynamic Policies Of The Firm - Die Hartzerkleinerung - Management Und Controlling Von Softwareprojekten - Vereintes Deutschland Geteilte Jugend - Mathematik Ingenieure - Die Kaufmnnische Apothekenhrung Und Die Spezialittenfabrikation - Das Rntgenbild Des Schdels Bei Intrakranieller Drucksteigerung Im Wachstumsalter - Cytology In Gynecological Practice Gynkologische Vitalzytologie In Der Praxis - Aus Forstlicher Theorie Und Praxis - Unternehmen Im Wettbewerb - Entwicklung Bau Und Bedeutung Der Keimdrsenzwischenzellen - Klinik Der Lungentuberkulose - Remote Sensing Digital Image Analysis - Baukosten Bei Neu- Und Umbauten - Die Atomionen Chemischer Elemente Und Ihre Kanalstrahlen-spektra - Neuordnung Oder Restauration - Zeiss Microscopes For Microsurgery - Umweltpolitik - Fehlerwelten - Oxygen Basis Of The Regulation Of Vital Functions In The Fetus - Das Tonwerk Im Rechtssinne - Zur Soziologie Des Essens - Data Compression - Der Weisstannenkrebs - Die Anatomie Des Menschen - Funkkolleg Altern 2 - Neuausrichtung Der Bundeswehr - Endovascular Treatment Of Intracranial Aneurysms - Dynamik Der Baukonstruktionen - Control Mechanisms In The Nervous System - Wrmediagramme Vergasung Verbrennung Und Ruybildung - Sicherheit In Der Unsicheren Gesellschaft - Environmental And Space Electromagnetics - Interkulturelles Personalmanagement - Kompetenz Zur Hrung - Vibration And Coupling Of Continuous Systems - Stadt Als Lokaler Lebenszusammenhang - Wrterbuch Der Kraftbertragungselemente Diccionario De Elementos De Transmisi³n Glossaire Dorganes De Transmission Glossary Of Transmission Elements Glossario Degli Organi Di Trasmissione Glossarium Voor Transmissie-organen Ordbok Fr Transmissionselement Voimansiirtoalan Sanakirja - Die Untersuchung Des Pulses Und Ihre Ergebnisse In Gesunden Und Kranken Zustnden - Grenzen Der Herrschaft - Quantum Electrodynamics - Human Resource Management Im Umbruch - Die Materialprfung Der Isolierstoffe Der Elektrotechnik - Chemische Funktionslehre - Assessment Of Cell Proliferation In Clinical Practice - Strfall Gender - Anleitung Ein Erfolgreiches Stadtentwicklungsprogramm - Practical Common Lisp - Technologietechnik - Stochastische Automaten - Die Vitamine - Vasopressin - Atmungs-pathologie Und -therapie - Automobil Verkehr Und Erziehung - Die Unipolare Gleichstrommaschine - Taking Your Ipad To The Max Ios 5 Edition - Machtkonzentration In Der Multimediagesellschaft - Vertrauen Und Wissen In Governance-prozessen - Sieve Elements - Holzsysteme Den Hochbau - Lehrbuch Der Bauphysik - Wolfsburg Stadt Am Wendepunkt - Organisation Und Steuerung Dezentraler Unternehmenseinheiten - Complications Of Dermatologic Surgery - Kernverfahrenstechnik - Sprache Und Kommunikation Im Alter - Die Grundlagen Des Technischen Denkens Und Der Technischen Wissenschaft - Handbuch Der Hartmetallwerkzeuge - Mediensozialisation - Mensch-computer-kommunikation - Aerodynamic Theory - Abhandlungen Aus Dem Aerodynamischen Institut An Der Technischen Hochschule Aachen - Psychotherapie Der Schlafstrungen In Der Nervenrztlichen Sprechstunde - Mhc + X - Arbeiter Unternehmer Professioneller - Elektronen Im Kristall - Tidal Deposits - Jugendkonsum Im Internationalen Vergleich - Employability And Mobility Of Bachelor Graduates In Europe - Advances In Clinical Neuropsychology - Laseranwendungen - Neuropsychologie - Leitfaden Der Din Normen - Architektur Mit Dem Computer - Das Maple Arbeitsbuch - Aktiv Und Konsequent Hren - M©ni¨re Disease - Surgical Research Recent Concepts And Results - Haustechnik - Internationale Kommunikation - Mobile Payment - Agrar-–ko-audit - Die Zerbrochene Wirklichkeit - Friedrich Gustav Kieyling - Praxiswissen Chemie Techniker Und Ingenieure - Handbuch Elektrotechnik - E-engineering - Exchange Server 2000 Installieren Konfigurieren Administrieren Optimieren - Die Frequenzkennlinien - Diskurs - Macht - Subjekt - Complications In Ptca - Hair Replacement Surgery - Dr Gablers Wirtschafts-lexikon - Formulieren Und Korrespondieren Im Beruf - Anleitungen Zum Arbeiten Im Elektrotechnischen Laboratorium - Advances In Fluid Mechanics And Turbomachinery - Die Geburt Der Eltern - Strategische Vertriebssteuerung - Einhrung In Die Internationale Rechnungslegung - Arrhythmiebehandlung Und Hmodynamik - Klausurtraining Technische Mechanik - Modeling Simulation And Optimization Of Complex Processes - Die Wasserheizung - Quality Of Life Assessment International Perspectives - Fortschrittliche Lagerung Und Behandlung Schwerverwundeter - Elektronische Kommunikation X400 Mhs - Proceedings Of The Xv Symposium Neuroradiologicum - Op-pflege Prfungswissen - Therapie Des Zervixkarzinoms - Einhrung In Die Physikalische Chemie Der Eisenhttenprozesse - Therapie Des Harnblasenkarzinoms - Das Vieweg Latex2ε-buch - Der Neuzeitliche Aufzug Mit Treibscheibenantrieb - Missbrauch Im Sozialstaat - Die Pathologische Physiologie Des Gesamtstoff- Und Kraftwechsels Bei Der Ernhrung Des Menschen - Erfolgreiche Strategien Die Kundenbindung - Distributed Environments - Demokratie Und Politik In Der Bundesrepublik 19491999 - Perioperative Management Of Patients With Rheumatic Disease - Die Psychologie Des Menschen Im Flugzeug - Fit Von 1 Bis Hundert - Zum Werk Leonhard Eulers - Die R- Evolution Im Informationsmanagement - Schwierigkeiten Mit Dem Gedenken - Dutch Elm Disease Research - Eeg Atlas For Anesthesiologists - Multisensuelle Unternehmenskommunikation - Strmung Durch Rohre Und Ventile - Austauschbare Einzelteile Im Maschinenbau - Der Apotheker Im Spiegel Der Literatur - Die Neueren Chemotherapeutischen Prparate Aus Der Chininreihe Optochin Im Besonderen Eukupin Und Vuzin Und Aus Der Akridinreihe Trypaflavin Rivanol - Das Pc-wissen It-berufe Hardware Betriebssysteme Netzwerktechnik - Contemporary Research In Engineering Science - Haut- Und Lederfehler - Demokratie Eine Kultur Des Westens - The Foundations Of Acoustics - Major Fractures Of The Pilon The Talus And The Calcaneus - Die Physikalischen Und Technischen Grundlagen Der Hochfrequenzbehandlung - Jugend Im Generationen-kontext - Elektronenmikroskopische Methodik - Die Institution Schule Und Die Lebenswelt Der Schler - Aktuelle Therapie Des Kardiakarzinoms - Systematic Geomorphology - Die Globale Agenda - Introduction To Polymer Physics - Endourology - Hermeneutischer Positivismus Und Dialektischer Essentialismus Vilfredo Paretos - Bekmpfung Hoher Grubentemperaturen - Die Generation Der Wende - Lungen- Und Rippenfellentzndung - Die Sozialen Aufgaben Der Arbeitgeber - Miteinander Von Kindern Und Alten Menschen - Der Hirnstamm Der Maus - Streitfall Natur - Citizenship - Soziologie Der Staatsbrgerschaft - Kurzes Lehrbuch Der Anorganischen Chemie - Die Schleifmaschine In Der Metallbearbeitung - Physiologie Und Funktion Von Pflanzenwurzeln - Die Wirtschaftliche Entwicklung Der Beiden Staaten In Deutschland - Grundzge Der Geschichte Und Wirtschaft Der Kniglichen Oberfrsterei Eberswalde - Auf Kurs Gebracht - Die Lehre Vom Wirtschaftsbetrieb - Solar Energy Conversion - Umwelt-und Naturschutz Am Ende Des 20 Jahrhunderts - Numerische Algorithmen In Softwaresystemen - Materialflusstechnik - Measurements In Pediatric Radiology - Die Arbeiterfrage - Free Radical Reactions In Medicine - Zusammenhalt Durch Vielfalt - Erfolgreiches Change Management In Der Post Merger Integration - Politische Reprsentation Schwacher Interessen - Die Chirurgische Behandlung Des Colon-carcinoms - Radiologische Funktionsdiagnostik Des Pharynx Und Des –sophagus - Methoden In Der Medizinischen Cytogenetik - Visual Basic Net Mit Methode - Kundenclubs And More - The Excretory Function Of Higher Plants - Vorsprung Durch Einmaligkeit - Management Der Organisation - Politische Sozialisation In Der Ddr - Die Vorkalkulation Im Kessel- Und Apparatebau - Peter Weiss Jahrbuch 2 - Dampfturbinen-verbrauchsdiagramme - Handbook Of Pediatric Cardiovascular Drugs - How Firms Can Strategically Influence Open Source Communities - Die Aktive Gesellschaft - Revision Surgery In Total Hip Arthroplasty - Jugendliche Video-cliquen - Werkstoffkunde - Gewaltenteilung Und Parteien Im Wandel - Steuerungstechnik Maschinenbauer - Professionalitt - Philosophia Perennis - Physik Im Lehrbuch 17001850 - Nichteheliche Lebensgemeinschaften - Soziale Arbeit In Lndlichen Rumen - Vergleichen In Der Politikwissenschaft - Jugend Und Soziale Bewegung - Lebensfragen - Das Radialbohren - Die Hochdrucklokalansthesie - Prfungsvorbereitung Organisation Und Datenverarbeitung - Die "wissensgesellschaft" - Festigkeitsberechnung Rotierender Scheiben - Die Moderne Selektivschutztechnik Und Die Methoden Zur Fehlerortung In Hochspannungsanlagen - Aus Der Werkstatt Der Psychoanalytiker - Zur Rationalitt Von Volksabstimmungen - Baumwollspinnerei - Kardiale Rhythmusstrungen - Die Niederspannungs- Und Hochspannungs-leitungsanlagen - Neue Kommunikationsnetze - Dichtung Und Menschenkenntnis - Topographic Brain Mapping Of Eeg And Evoked Potentials - Gradient Hplc Of Copolymers And Chromatographic Cross-fractionation - Die Elektronenrhre Als Physikalisches Meygert - Recent Contributions To Fluid Mechanics - Wege Zur Deutung - Handbuch Politische Gewalt - Atlas Of Mammography - Das Pneumencephalogramm - Teamintelligenz Ein Intelligentes Team Ist Mehr Als Die Summe Seiner Kompetenzen - Handbuch Marketing-kommunikation - Hrung Auf Distanz - Leitfaden Das Maschinenzeichnen - Indikation Zur Operation - Ethnologie Anfnger - Harmonisierung Demographischer Und Sozio-konomischer Variablen - Diagnostic Evaluation Of The Knee - Cyberbeben - Toleranz Weisheit Liebe Oder Kompromiss - Faszination Wolfsburg 1938-2012 - Der Beton - Stochastische Prozesse Ingenieure - Das Wesen Des Guybetons - Die Patentrecherche - Practical Api Design - Sql Server 2012 Integration Services Design Patterns - Wirtschaftslehre Bankkaufleute - Eisenbahngterverkehr - Logic And The Organization Of Information - Kompetent In Die –ffentlichkeit - Nutritional Management Of Cancer Treatment Effects - Energy Transport And The Environment - Bilanz Der Bundestagswahl 2002 - Chaulmoogral - Evolution Der Sprache Und Vernunft - Konfliktmanagement Und Gewaltprvention - Interpersonales Vertrauen - Gesellschaft Und Tiere - Politische Bildung Und Globalisierung - Prozeyinformatik - Messungen In Fluvialen Systemen - Laser In Forschung Und Technik Laser In Research And Engineering - Die Genfer Scheckrechtsabkommen - Controlling Im Gesundheitsbetrieb - A Course In Mathematical Physics 1 - Einhrung In Die Regelungstechnik - Datenbertragung Technik Der Daten- Und Textkommunikation - Integrierte Produktentwicklung - Zukunftsfeld Dienstleistungsarbeit - Applied Stochastic System Modeling - Die Politik Der Infosphre - Atlas Of Color-coded Doppler Sonography - Wie Allein Sind Alleinerziehende - Grundlagen Der Technischen Thermodynamik - Leadership By Soft Skills - Politische Integration - Die Neueren Arzneimittel Und Die Pharmakologischen Grundlagen Ihrer Anwendung In Der Rztlichen Praxis - Mehrgryenregelungen - Einhrung In Die Mechatronik - Bilder Und Skizzen Aus Der Geschichte - Die Maschinenelemente - Geschichte Der Erwachsenenbildung In Deutschland - Ellenbogenmentalitt Und Fremdenfeindlichkeit Bei Jugendlichen - Embryologie Und Fortpflanzungsbiologie Der Angiospermen - Materials Sciences In Space - Advances In Turbulence 2 - Wandel Durch Demokratie - Wirtschaftspolitik Und Regierungssystem Der Bundesrepublik Deutschland - Im Widerstreit - Modernization Science - Handbuch Medienwirkungsforschung - Jugendliche Whler In Den Neuen Bundeslndern - Die Lehre Von Den Pupillenbewegungen - Pdiatrische Gynkologie - Erfolgreiches Depotmanagement - Modified Inferior Turbinoplasty - Strahlungsquellen Technik Und Medizin - Speed Selling - Dekorp-atlas - Hrungsgrundstze Und Mitarbeiterhrung - Stadtgesellschaft Und Kindheit Im Prozey Der Zivilisation - Die Psychosoziale Situation Von Auslndern In Der Bundesrepublik - Zum Verhltnis Von Subjekt Und Organisation - Java It-berufe - Nutzerakzeptanz Von Webbasierten Anwendungen - Beginning C 50 Databases - Das Sas Survival Handbuch - Numerische Mathematik Ingenieure - Sonnenkollektoren - Wirtschaftliche Produktion „geistiger Gter In Einer Selbstbestimmten Erwerbswelt - Analyse Der Fette Und Wachse - Bettine Von Arnims Briefromane - Die Syntax Des Tempus - Next Economy - Unternehmensverkauf - Unternehmensbewertung In Theorie Und Praxis - Chemical Mutagenesis In Mammals And Man - The New World Of Economics - Gesetz Ber Die Aufwertung Von Hypotheken Und Anderen Ansprchen Aufwertungsgesetz Vom 16 Juli 1925 Und Durchhrungsverordnung Vom 29 November 1925 - Excel 2010 For Educational And Psychological Statistics - Die Pilon-tibial-fraktur - Marketing Lohas - Dissipative Structures And Chaos - Deutsche „rzte - Reden - Principles Of Dispersal In Higher Plants - Handbuch Der Modellstatik - Erfinden Und Konstruieren - Brgerkonferenz Streitfall Gendiagnostik - Politikverflechtung Im Vereinigten Deutschland - Schulforschung Fallanalyse Lehrerbildung - Primary Bone Tumors And Tumorous Conditions In Children - Analysis Mit Maple - Kommunikation –ffentlichkeit –ffentlichkeitsarbeit - Der Durchlaufende Trger Ber Ungleichen –ffnungen - New Directions Of Oceanographic Research And Development - Gelegenheit Und Entscheidung - Kinder-rituale Zwischen Vorder- Und Hinterbhne - Einhrung In Die Markscheidekunde Mit Besonderer Bercksichtigung Des Steinkohlenbergbaues - Gewerbliche Vergiftungen - Management · Werte Organisation - Hchstdruckdampf - Die Wirtschaftlich Gnstigste Spannung Fernbertragungen Mittelst Freileitungen - Internationale Rechnungslegung - Das Armenisch-aserbaidschanische Verhltnis Und Der Konflikt Um Berg-karabach - One-to-one- Marketing Im Internet - Informationsverarbeitung - Email Und Emailliertechnik - Grundlagen Und Mathematische Hilfsmittel Der Hochfrequenztechnik - Anorganische Chemie Auf Physikalisch-chemischer Grundlage - Die Gesellschaftlichen Folgen Der Medienkonzentration - Dynamik Von Schadstoffen Umweltmodellierung Mit Cemos - Grundkurs Wirtschaftsinformatik - Drehstrommotoren Mit Doppelkfiganker Und Verwandte Konstruktionen - Late Reconstructions Of Injured Ligaments Of The Knee - Software-praktikum - Die Tierwelt In Heilkunde Und Drogenkunde - Elektrochemie - Handbuch Usa-geschft - Konservative Und Operative Orthopdie - Die Entstehung Der Arten Und Hheren Kategorien - Motivation Und Begeisterung - Brgschaft Des Inneren Friedens - Disney Stories - Schauderhaft Banales - Psycho-logic - Cholecystokinin Antagonists In Gastroenterology - Soziale Form Und Konomisches Objekt - Kompakt-lexikon Umwelt- Und Wirtschaftspolitik - Bilder Der Arbeit - Nfstellige Funktionentafeln - Textile Faserstoffe - Marine Geology And Oceanography Of The Arctic Seas - Kontinuumsschwingungen - Die Forsteinrichtung - Glaukom - Genital Papillomavirus Infections - Hessen Im Wandel - Psychophysics In Action - Der Mineralbestand Des Krpers - Eliten In Deutschland - Light Scattering Spectra Of Solids - Betriebswirtschaftliches Kontaktstudium - Venous Valves - Interessenvermittlung Zwischen Konkurrenz Und Konkordanz - Die Berechnung Von Rotierenden Scheiben Und Schalen - Die Erkrankungen Der Blutdrsen - First Steps In Mathematica - Die Kontrolle Des Dampfkesselbetriebes In Bezug Auf Wrmeerzeugung Und Wrmeverwendung - Frderung Von Kindern Mit Migrationshintergrund - The Making Of Regions In Post-socialist Europe The Impact Of Culture Economic Structure And Institutions - Kombinationstherapie Der Herzrhytmusstrungen Mit Chinidin Und Verapamil - Schadstoffe In Elektrischen Und Elektronischen Gerten - Kleines Wrterbuch Der Marxistisch-leninistischen Philosophie - Allgemeine Chirurgie - Lehrbuch Der Zahnrztlichen Kronen- Und Brckenprothetik - Das Visionre Unternehmen - Die Extreme Rechte In Der Bundesrepublik - Graue Eminenzen Der Macht - Matlab For Psychologists - Eifersucht Bewltigen - Die Exportmglichkeiten Der Deutschen Maschinenindustrie - Remote Sensing Of The Earth From Space Atmospheric Correction - Sakulrisierung Und Resakralisierung In Westlichen Gesellschaften - Grundkurs Regelungstechnik - Bildungsidentitt - Der Weg Zur Biogeologie - Immunglobuline In Der Klinischen Neurologie - Was Manager Von Der Blattlaus Lernen Knnen - Erfahrungen Im China-geschft - Der Aufbau Der Materie - Kunstglieder Und Orthopdische Hilfsmittel - Wrterbuch Der Marxistisch-leninistischen Soziologie - Digitale Bildgebende Verfahren Interventionelle Verfahren Integrierte Digitale Radiologie - Cad Referenzmodell - Gelenkzerstrung Bei Entzndlichen Rheumatischen Erkrankungen - Stadtentwicklung In Ostdeutschland - Nuclear Medicine Imaging An Encyclopedic Dictionary - Tectonics Of The Southern Central Andes - Hygienisches Taschenbuch - Analysis - Arbeitsbuch - Aachener Bausachverstndigentage 2002 - Jungen- Und Mnnerarbeit - Werte Und Nationale Identitt Im Vereinten Deutschland - Die Fernrohre Und Entfernungsmesser - Praxishandbuch Immobilieninvestments - Das Vlkerrecht - Die Zukunft Der Gemeinwesenarbeit - Cobol - Tropische Hochgebirgspflanzen - Transformationen Und Signale - Seh- Und Hreinbuyen Lterer Menschen - Einhrung In Das Marketing - Judentum Und Kommunismus - Krperschaftsteuer In Der Unternehmenspraxis - Berufsfindung Und Geschlecht - Die Selbstttige Regelung In Der Elektrotechnik - Sekretariatskunde Mit Edv - Computergrafik Und Bildverarbeitung - Moderne Staatsbrgerschaft - Elektrotechnik Auf Handelsschiffen - Fernsehgebrauch Und Geschlecht - Die Entstehung Des Neuen In Der Adoleszenz - Einhrung In Die Elektrische Messtechnik - Shock Waves In Materials Science - Rationales Handeln Und Soziale Prozesse - Algebraische Grundlagen Der Informatik - Solidaritt Lebensformen Und Regionale Entwicklung - Druckstollenbau - Emotion Gesellschaft Und Kultur - Lehren Und Lernen An Der Internationalen Frauenuniversitt - Neuroblastoma - Deutsches Kranbuch - Die Mitte - Paare Im Wandel - Moderne Mythen Der Medizin - Die Jute Und Ihre Verarbeitung Auf Grund Wissenschaftlicher Untersuchungen Und Praktischer Erfahrungen - Persnliche Netzwerke In Stadt Und Land - Familienformen Im Sozialen Wandel - Soziologische Ausflge - Begriffe Besetzen - „rockmobil - Middleware - Gesundheit Und Soziale Lage Von Jungen Menschen In Europa - Die Ordnung Der Freiheit - Musikfernsehen In Deutschland - Jugendlicher Rechtsextremismus Und Gewerkschaften - Die Technik Des Bankbetriebes - Die Wirklichkeit Der Medien - Praxishandbuch Corporate Magazines - Das Entscheidungssystem Der Europischen Union - Kulturmanagement - Berichterstattung Zur Soziokonomischen Entwicklung In Deutschland - Thermoreception And Temperature Regulation - Die Praxis Der Zahnextraktion Einfchlieylich Der Rtlichen Schmerzbetubung - Beyond The Pale - Perspectives On Human Suffering - Politik Und Wirtschaft - Der Schdelschuy - The Influence Of Antibiotics On The Host-parasite Relationship Iii - Algebraic Structures - Konfliktmanagement Bei Groupware - Frieden Und Konflikt - Quantitative Social Research In Germany And Japan - Aktienrechtliche Jahresabschluyprfung - Klnge Und Gerusche - Pseudopotentiale - Mri Atlas Of Central Nervous System Tumors - Systemtransformation - Advances In Superconductivity Ii - Lehrbuch Der Waldwertrechnung Und Forststatik - Fernsehgewalt Im Gesellschaftlichen Kontext - Current Practice Of Fracture Treatment - Betriebs-chemie Maschinenbauer Und Elektrotechniker - Das Atom Und Die Bohrsche Theorie Seines Baues - Schriften Der Arbeitsgemeinschaft Deutscher Betriebsingenieure - Elektrotechnische Winke Architekten Und Hausbesitzer - Aktuelle Medientrends In Den Usa - Korruption - Timingstrategien In Innovationspartnerschaften Der Deutschen Ernhrungsindustrie - Die Wissenschaftlichen Grundlagen Der Nassen Erzaufbereitung - Das Konstrukt „bevlkerung Vor Im Und Nach Dem „dritten Reich - Chancengleichheit Im Bildungswesen - Politikwissenschaft In Deutschland - Sexuelle Szenen - Coordination Chemistry In Non-aqueous Solutions - Sexology - Vascular Diagnostics - From The Atomic Bomb To The Landau Institute - Politikwissenschaft Die Soziale Arbeit - Kapitalanlage Versicherungen - Die Politische Konstitution Von Mrkten - Handbuch Der Schutzimpfungen - Bilanzanalyse Mit Ms Access - Die Innovationsfhigkeit Der Organisationsgesellschaft - Die Entstehung Von Groyeisenindustrie An Der Deutschen Seekste - The Global Victimization Of Children - Handbuch Politische Partizipation Von Frauen In Europa - Von Geheimen Politikmachern Und Wissenschaftlichen Hoflieferanten - Blutungskrankheiten - Amtstrger In Der Parteiendemokratie - Migration Und Geschlechterverhltnisse - Microdosimetry And Its Applications - European Solar Radiation Atlas - Der Integrationsgedanke In Der Betriebswirtschaftslehre - Israel In Nahost Deutschland In Europa Nahtstellen - Forever Young - Lehrbuch Der Speziellen Pathologie Und Therapie Der Inneren Krankheiten Studierende Und „rzte - Differential Geodesy - Algorithms For Graphics And Image Processing - Die Russische Hunger- Und Seuchenkatastrophe In Den Jahren 19211922 - Modeling Dynamic Transportation Networks - Behandlung Der Verletzungen Und Eiterungen An Fingern Und Hand - Erfolg Durch Resonanz - Branded Component Strategies - Karrieremanagement - Ehrenamt Und Integration - Die Gemeinschdlichkeit Der In Aussicht Gestellten Erhhung Der Kornzlle - Armut Und Zeit - Carbohydrate Metabolism In Pregnancy And The Newborn · Iv - Integration Durch Verfassung - Pathophysiologie Und Rationale Pharmakotherapie Der Myokardischmie - Umweltorientierte Materialwirtschaft - Recent Developments In Alcoholism - Die Stadt Das Fremde Und Die Furcht Vor Kriminalitt - Innovatorenorientierte Akzeptanzforschung Bei Innovativen Medientechnologien - Paradigmenwechsel In Der Technologiepolitik - Kostenrechnung 2 - Digitale Demokratie - Menschen Auf Der Flucht - Urinary Enzymes - Grundzge Der Beleuchtungstechnik - Fem Bei Elektrischen Antrieben 1 - Das Wesen Der Erfindung - Staat Und Glck - Isostasie Und Schweremessung - Die Neue Radikale Rechte Im Vergleich - Elementar-mechanik Maschinen-techniker - Rollenspiele In Kommunikations- Und Verhaltenstrainings - Computergesttzte Fuychirurgie - Variation-aware Design Of Custom Integrated Circuits A Hands-on Field Guide - Technikethik Und Wirtschaftsethik - Dermatologie Und Rheuma - Unser Alltag Ist Voll Von Gesellschaft - Akupressur Und Moxibustion - Kinder Auf Der Flucht - Negative Hermeneutik - Luhmann Modelliert - Masterkurs Parallele Und Verteilte Systeme - Wertschpfungsmanagement Im Einkauf - Grundlagen Der Statistik Und Ihre Anwendungen - Metallfachkunde 1 - Applied Multivariate Statistics In Geohydrology And Related Sciences - Informatik Pc-orientierte Informationstechnische Grundbildung - Basic Notes In Psychiatry - Critical Levels In The Development Of Natural Systems - Der Mensch Und Seine Medien - Praktische Betriebslehre - Office-based Infertility Practice - Soziologie In Pdagogischen Kontexten - Systemtheorien Im Vergleich - Aufgaben Aus Der Hydromechanik - Patent Filing Strategies And Patent Management - Wrmetheorie - Die Gifte In Der Weltgeschichte - Chaos In Switching Converters For Power Management - Lebensthemen Junger Frauen Die Andere Vielfalt Weiblicher Lebensentwrfe - Abdominale Ultraschalldiagnostik - Atlas Of Peripheral Nerve Ultrasound - Umweltpolitik In Ost- Und Westeuropa - Reengineering Zwischen Anspruch Und Wirklichkeit - Deutschland Nach Der Wende - Metriken - Der Schlssel Zum Erfolgreichen Security Und Compliance Monitoring - Evozierte Potentiale Im Verlauf - Diskursanalyse Von Verkaufsgesprchen - Lehrbuch Der Pharmakognosie - Online-journalismus - Modellbildung Und Simulation - Clinical In Vitro Fertilization - Glass Chemistry - Az Handbuch Asbestzementrohre - Optimierungsmethoden Des Operations Research - Entrepreneurship Governance And Ethics - Regieren In Der Bundesrepublik I - Moral Kommunikation Organisation - Aktuelle Kernfragen In Der Psychiatrie - Unternehmenshrung Und Kapitalmarkt - Sozialstaat In Europa - Existenzgrndung It - Die Physiologie Und Pharmakologie Des Flimmerns - Die Eisenkonstruktionen - Sozialismus Und Soziologie - Die Entwicklung Des Verkehrs - Grundlagen Der Betriebsrechnung In Maschinenbauanstalten - Einhrung In Die Strmungsmechanik - Betriebliche Soziale Arbeit - Geschichte Und Struktur Des Deutschen Parteiensystems - Entwurf Und Diagnose Komplexer Digitaler Systeme - Allgemeine Wechselstromlehre - Textformulierung Sekretrinnen - Das Kriegsgeschehen 2000 - Morphological Astronomy - Bibliographie Der Verffentlichungen Ber Den Leichtbau Und Seine Randgebiete Im Deutschen Und Auslndischen Schrifttum Aus Den Jahren 1955 Bis 1959 Bibliography Of Publications On Light Weight Constructions And Related Fields In German And Foreign Literature From 1955 To 1959 - Empowering Open And Collaborative Governance - Europischer Journalismus - Numerische Methoden In Der Technik - Das Fotoalbum Weierstray A Photo Album For Weierstrass - Gesellschaft Im Wandel - Versprechungen Des „sthetischen - Coeliac Disease - Dimensional Analysis And Scale-up In Chemical Engineering - Fortschritte Der Botanik - Magnetic Resonance And Related Phenomena - Blut Und Lymphe - Die Nachbehandlung Nach Chirurgischen Eingriffen - Brgerliches Recht Betriebswirte - Turbo-pascal In Beispielen - Internetrecht - Materialien Zur Soziologie Des Alltags - Growth Hormone And Somatomedins During Lifespan - Der Hrer In Die Lebermoose Und Die Gefykryptogamen - Handwrterbuch Zur Politischen Kultur Der Bundesrepublik Deutschland - Einheitliche Bezeichnung Der Lokomotiven Tender Und Triebwagen - Immunopharmacology Reviews - Der Temperguy - Individualisierung Und Soziologische Theorie - Abfallentsorgung Im Ausland - Riskante Strategien - Der Theoretische Wrmeverbrauch Einer Rohzuckerfabrik Verdampfen Erwrmen Verkochen Und Krafterzeugung - Diffusion Und Globalisierung - Ddr-jugend - Handelsbilanzen - Klassische Diesel-einspritzsysteme - Grundbegriffe Des Stdtebaues - Breast Cancer 4 - Mittel- Und Langfristige Exportfinanzierung - Smiths Sea Fishes - Die Dynamik Organisierter Beschftigungsfrderung - Beitrge Zur Angewandten Mikrokonomik - Print Medium Mit Zukunft - Beobachten Und Nachdenken - Bedeutung Und Wesen Des Patentanspruchs - Notflle In Gynkologie Und Geburtshilfe - Soziale Kontrolle - Der Bauratgeber - Bau Einrichtung Und Betrieb Ffentlicher Schlacht- Und Viehhfe - Nonlinear Evolution Of Spatial Economic Systems - Bericht œber Die Achtundvierzigste Zusammenkunft Der Deutschen Ophthalmologischen Gesellschaft In Heidelberg 1930 - Finite Dimensional Algebras - Fertigungstechnik Von Luft- Und Raumfahrzeugen - Cruise Management - Exzellenz Im Dienstleistungsmarketing - Die Durchlssigkeit Der Haut Arzneien Und Gifte - Optimale Standortwahl Im Einzelhandel - Betriebsprogramme In Rechenanlagen - Die Strukturkrise Der Strukturpolitik - Emil Fischer - Kosten-nutzen-analyse Von Beruflicher Weiterbildung - Thallium Myocardial Perfusion Tomography In Clinical Cardiology - Messung Mechanischer Schwingungen Dynamik Der Schwingungsmeygerte - Pro Html5 Accessibility - Global Denken Global Gewinnen - Ausgrenzung Macht Krank - Wahlfreiheit In Der Fernsehnutzung - Silizium-halbleitertechnologie - Power Sonic And Ultrasonic Transducers Design - Cardiac Valve Allografts 19621987 - Handbuch Der Virusforschung - Navigating In Educational Contexts - Arbeitslosigkeit Und Wohlfahrtsstaat In Westeuropa - Die Berflssige Jugend Der Arbeitsgesellschaft - Miscellanea Mathematica - Publizieren - Mathematikunterricht In Der Sekundarstufe Ii - Finanzinnovationen - Brustkrebs - Bankdienstleistungen Kundenorientiert Verkaufen - Soziale Kommunikation - New Connectivities In China - Aushandlung Ohne Dissens - Technischer Lehrgang Starterbatterien - Die Neurologisch-neurochirurgische Frhrehabilitation - Wahlen Und Wahlkampf In Den Medien - Die Infektion Beim Brandverletzten - Altersvorsorge 2012 - Human Resources Management In Banken - Akzeptanz - Handbuch Spezielle Soziologien - Betriebswirtschaftslehre Der Industrie - Die Neue Kommunikationswissenschaft - Lehrbuch Der Funktionentheorie - Kinderarmut Und Generationengerechtigkeit - Staat Und Schnheit - Technische Mechanik - Engineering Mechanics - Wasserbau Und Wasserwirtschaft In Deutschland - Coping And Self-concept In Adolescence - Die Radikalisierte Moderne - Drugs Neurotransmitters And Behavior - Bildung Und Wissenschaft Seit Der Wende - Allgemeine Mechanik Der Elektrizitt - Die Liberalen Parteien Angesichts Der Zukunft Preuyens - Dynamische Systeme Und Fraktale - Der Kraftwechsel Des Kindes - Lndliche Netzwerke - Werbepdagogik In Der Grundschule - Demokratie Und Das Sdliche Afrika - Hebammenlehrbuch - Verkehrsmedizin - Mehr Gewinn Durch Systematische Vermgensplanung - Spielrume In Der Konstruktion Von Geschlecht Und Familie - Resourcing - Einhrung In Die Chemie - Surgical Anatomy And Technique - Aachener Bausachverstndigentage 2008 - Die Beobachtung Von Kommunikation - Neue Anstze Im Kulturmanagement - Rutschungen Und Ihre Sanierung - Verstehen Und Kultur - Literatur Als System - Stdtebauliches Entwerfen - Soziale Stadt Sozialraumentwicklung Quartiersmanagement - Bauen Im Bergbaugebiet - Die Ablsung Und Regelung Der Waldgrundgerechtigkeiten - Theoretische Atomphysik - Die Apparatefrberei - Politische Techniksteuerung - Das Sterreichische Bergschadenrecht Unter Bercksichtigung Des Deutschen Bergrechtes - Chancen Und Risiken Von Rohstoffinvestments - Das Zwiespltige Individuum - Cross Border Experts 2011 - Ios 5 Recipes - Advances In Human Genetics 6 - Datenreisende - Der Wandel Nach Der Wende - Kommentar Zur Wrmeschutzverordnung 1995 - Chefentlastung - Eustachian Tube And Middle Ear Diseases - Politische Kommunikationskultur - Design For Innovative Value Towards A Sustainable Society - Acamprosate In Relapse Prevention Of Alcoholism - Betriebliche Informationskonzepte - Der Sozialrumliche Blick Der Jugendarbeit - Geschwisterkonstellation Und Psychische Fehlentwicklung - Neue Rechte Und Rechtsextremismus In Europa - Biomasse - Molecular Geometry Of Body Pattern In Birds - Expert Systems In Environmental Planning - Der Nahrungsmittelchemiker Als Sachverstndiger - Asphaltstrayen Und Teerstrayen - Sicherheit In Freiheit - Emil Rathenau Und Das Werden Der Groywirtschaft - Das Heartbeat-modell - Anlagechancen 2008 - Handbuch Der Landmaschinentechnik - Mey- Steuerungs- Regelungstechnik - Antiepileptic Drug Interactions - Sensoren Die Prozess- Und Fabrikautomation - Seafood Proteins - Kommentar Krperschaftsteuer Kstg - Petroleum Formation And Occurrence - Zukunftsbranche Biotechnologie - Griechische Kriegsaltertmer Hhere Lehranstalten Und Den Selbstunterricht - Organizational Politics - Einhrung In Die Kinderheilkunde - Grundlagen Elektrischer Maschinen Und Antriebe - Ein Haus In Europa - Das Interpretative Paradigma - Die Behandlung Innerer Krankheiten Mit Radioaktiven Substanzen - Schwer Vermittelbar - Current Cardiovascular Drugs - Die Theorie Der Gewichtsstaumauern Unter Rcksicht Auf Die Neueren Ergebnisse Der Festigkeitslehre - Dem Andenken An Reinhard Dohrn - Deutsche Direktinvestitionen In Der Volksrepublik China - Teaching Drama In The Classroom - Handbuch Digitaler Schnittstellen - Mehrfachregelungen Grundlagen Einer Systemtheorie - Die Therapie Des Praktischen Arztes - Polymer Rheology - Soziologie Der Kommunikationsmedien - Adolescent Parenthood - Artillerie Und Ballistik In Stichworten - Praxishandbuch Rockmusik In Der Jugendarbeit - Drucklufterkrankungen - Learning Democracy In School And Society Education Lifelong Learning And The Politics Of Citizenship - Islamophober Populismus - Drug Discovery And Evaluation Safety And Pharmacokinetic Assays - Weltpolitik Im 21 Jahrhundert - Literaturtheorie Und Geschichte - Glubigerstrategien Im Schuldnerkonkurs - Pdagogik Als Vergleichende Kulturwissenschaft - Die Chemisch-technischen Untersuchungs-methoden Der Zellstoff- Und Papier-industrie - Die ‚erbpolizei‛ Im Nationalsozialismus - Mikroroboter Und Mikromontage - Operations Research 1 - Dynamics Of Multibody Systems - Grundzge Der Pflanzenanatomie - Die Selbststrukturierung Der Materie - Militr Als Gegenkultur - Funktionentheorie - Die Entwicklung Des Soziologischen Wissens - On The Movement Of Animals - Handbuch Medienarbeit - Die May- Und Gewichtsordnung - Rntgendiagnostik Im Kindesalter - Markenmanagement In Der Motorradindustrie - Der Berzeugende Persnliche Auftritt - Die Gewerkschaften In Politik Und Gesellschaft Der Bundesrepublik Deutschland - Klinische Vektor-elektrokardiographie - Persnlichkeit Und Subjektivitt - Stadtregion Und Wissen - Gesundheitssorge Soƶiale Und Private Versicherung - „aneignung Als Bildungskonzept Der Sozialpdagogik - Das 1 — 1 Erfolgreicher Verkufer - Psychotherapeutische Interaktion - Arthroscopy Of The Shoulder - Physik Des Ultraschalls - Betriebsanalysen - Bauelemente Und Grundschaltungen - Macromolecules - Modern Treatment Of Severe Burns - Female Contraception - Ethics And Human Genetics - Strategie Und Sicherheitspolitik - Human Development And Health - Handbuch Medienproduktion - Publizistik Im Vernetzten Zeitalter - Handbuch Direct Marketing - Robert Michels Soziologie Des Parteiwesens - Economic Theory And International Trade - Tragwerkslehre In Anschauungsmodellen - Von Der Diktatur Zur Demokratie - Dynamische Systeme Steuerbarkeit Und Chaotisches Verhalten - Handbuch Soziale Arbeit Und Alter - Die Physikalischen Grundlagen Der Anwendung Radioaktiver Oder Stabiler Isotope Als Indikatoren - Sonographische Diagnostik Des Skrotalinhalts - Light Scattering In Solids - Zero-phonon Lines - Der Entzndungsbegriff - Deutsche Waldwirtschaft - Vernetztes Verkaufen - The Neuropathology Of Hiv Infection - Elemente Der Funktionalanalysis - Programmieren Spielend Gelernt Mit Dem Java-hamster-modell - The Rust Fungi Of Cereals Grasses And Bamboos - Orale Photochemotherapie - Simultaneous Engineering - Vektoranalysis - Die „erfolgsspirale Der Ungleichzeitigkeit - Grundfragen Des Mathematikunterrichts - Hard Tissue Mineralization And Demineralization - Die Elektrolyte - Analog Circuit Design For Process Variation-resilient Systems-on-a-chip - Ausgewhlte Schriften - Biologie Des Menschen - Document Architecture In Open Systems The Oda Standard - Kommunikation In Der Organisation - Vorsorgendes Hochwassermanagement Im Wandel - Personalentwicklung Im Wandel - Bildungssysteme Und Soziale Ungleichheit - Nebenwirkungen In Der Onkologie - Syntaktische Grenzen - Knstliche Intelligenz Und Heuristisches Programmieren - Technische Elektronik - Medienwirkungen Kompakt - Untersuchungstechniken In Der Echokardiographie - Die Ganz Alltgliche Gewalt - Hrer Durch Die Elektrizittswirtschaft - Opferschutz Im Strafverfahren - China Champions - Einhrung In Die Erziehungswissenschaft - Betriebswirtschaft Architekten Und Bauingenieure - Herrschaft Und Soziale Ordnung - Waren Und Dienste - Klinik Und Atlas Der Chronischen Krankheiten Des Zentralnervensystems - History Of Free Skin Grafting - Bildungspolitik In Deutschland 19451990 - Geographie Die Verkehrswirtschaft - Preuyische Personalabbau Bei Staat Und Gemeinden - Brgerliches Recht 2 - Praxis Der Angiologischen Diagnostik - Infantile Autism - Versicherungsbetrug Verstehen Und Verhindern - Static Electrification - Richtlinien Zur Medizinischen Indikation Der Schwangerschaftsunterbrechung - Was Tun - Fluidik - Produktklassiker - Allgemeine Energiewirtschaft - Offene Systeme - Spezielle Chirurgische Diagnostik - Die Wirkung Verbaler Und Nonverbaler Kommunikation In Tv-duellen - Innovationsrisikomanagement Im Krankenhaus - Lost Brands - Vom Aufstieg Und Niedergang Starker Marken - Informations- Und Wissensverarbeitung In Den Sozialwissenschaften - Acute Peripheral Vascular Surgery - Ein Neues Kulturelles Modell - Principles Of Quantum Mechanics - Die Schleimhute Des Ohres Und Der Luftwege - Strategisches Affinity-group-management - Das Interkulturelle Lehrerzimmer - It-projekte Strukturiert Realisieren - Nachhaltigkeitswissenschaften - Innovationsfhigkeit Durch Reflexivitt - Annahme Verweigert - Bildung Unter Bedingungen Kultureller Pluralitt - „rzte Oder Wunderheiler - Adressaten Nutzer Agency - Die Welt Der Vektoren - Rolle Status Erwartungen Und Soziale Gruppe - E-bilanz - Neue Generation Neues Erzhlen - Biologische Psychiatrie Der Gegenwart - Die Ltrohranalyse - The Implantable Cardioverterdefibrillator - Die Wiederentdeckung Der Diaspora - Verbrennungskraftmaschinen - Das Wealth-management-team In Der Kundenbetreuung - Prfungsvorbereitung Sekretrinnen - Haushalte Ohne Auto - Personale Gesundheitliche Und Umweltressourcen Im Alter - Campylobacter Pylori - Die Entropietafel Luft Und Ihre Verwendung Zur Berechnung Der Kolben- Und Turbo-kompressoren - Vergaberecht In Der Unternehmenspraxis - Einhrung In Die Geometrische Und Physikalische Kristallographie - Handbuch Tauchunflle - Nlp Im Business - Ditetik Innerer Erkrankungen - Selektion In Der Heilanstalt 1939-1945 - Die Wirthschaftliche Einteilung Der Forsten Mit Besonderer Bercksichtigung Des Gebirges In Verbindung Mit Der Wegenetzlegung - Jugend An Der Wende Vom 20 Zum 21 Jahrhundert - Der Regelvorgang Bei Kraftmaschinen Auf Grund Von Versuchen An Exzenterreglern - Kohlenstaubfeuerungen - Erziehungswissenschaftliche Zugnge Zur Waldorfpdagogik - Jugendzeit Time Out - Bowling Together - Die Verunsicherte Generation - Bahnhofsverzeichnis Zum Achsdruckverzeichnis - Software-prfung - Principles Of Turbomachinery - Extrakorporale Zirkulation Heute - Atlas Der Spaltlampenmikroskopie Des Lebenden Auges - Nichtlineare Mechanik - Gender Methodologisch - Aufgaben Und Lsungen Aus Der Gleich- Und Wechselstromtechnik - Progress In Proctology - Einhrung In Die Stadtplanung 3 - Was Top-verkufer Auszeichnet - Eine Frage Des Geschlechts - Drogisten-lexikon - The Nuclear Shell Model - Theoretical Physics Text And Exercise Books - Investigation Of Anorectal Functional Disorders - Die Moderne Und Ihre Vornamen - Obstetric Fistula - Clay Sedimentology - Handwrterbuch Des Politischen Systems Der bundesrepublik Deutschland - Fehlzeiten Wirksam Reduzieren - Der Petroleum-ingenieur - Uro-sonographie - Physik Der Ferrite Und Der Verwandten Magnetischen Oxide - Elemente Der Regelungstechnik - Durch Luhmanns Brille - Computational Mechanics 95 - Der Verkauf Elektrischer Arbeit - Der Neue Mobile-commerce - Standards Die Politische Bildung - Hochfrequenz- Und Lasertechnik In Der Medizin - Politik Als Kampagne - Random Signals And Processes Primer With Matlab - 27 Kongrey Der Deutschen Gesellschaft Soziologie Gesellschaften Im Umbruch - Wrter In Der Politik - Sicherheitspolitik In Lateinamerika - The Beginnings Of Cancer In The Cell - Mediation Erforschen - Centrum - Density Functional Theory - Adaptiogenese Und Phylogenese - Einhrung In Die „protestantische Ethik Max Webers - Der Kaffee - Internationalisation And Mode Switching - Free Radicals In The Brain - Bone Circulation And Bone Necrosis - Graphische Kinematik Und Kinetostatik Des Starren Rumlichen Systems - Handlungsproblem Computer - Chemische Laboratoriumstechnik - Politische Institutionalisierung Und Konflikttransformation - Soziologische Beratung - Strategisches Fundraising - Das Elend Der Suchtprvention - Famotidin Heute - Lehrbuch Des Obstbaus Auf Physiologischer Grundlage - Repetitorium Funktionentheorie - Rotordynamics Of Automotive Turbochargers - Leichtbau-konstruktion - Expertinnen Machen Schule - Das Forschungsprojekt - Systemwechsel Und Demokratisierung - Creo Parametric 20 Einsteiger - Kurz Und Bndig - Energie - Einhrung In Die Mechanik Akustik Und Wrmelehre - Die Dritte Generation Der „roten Armee Fraktion - Die Grundlagen Der Einsteinschen Gravitationstheorie - Digitale Subtraktionsangiographie In Klinik Und Praxis - Politischer Unterricht Demokratische Verpflichtung Und Soziale Verantwortung - Proceedings Of A Conference On Local Fields - Dynamik Regelung Und Dampfverbrauch Der Dampffrdermaschine - Das ‚bessere Geld - Der Betriebskoeffizient Der Eisenbahnen Und Seine Abhngigkeit Von Der Wirtschaftskonjunktur - Sehen Lernen In Der Fernsehgesellschaft - High Precision Navigation - Die Reduktion Der Eisenerze - Sharing Expertise Als Kern Von Wissensmanagement - Entwurf Und Bau Von Schaltanlagen Drehstrom-kraftwerke - Grundriy Einer Meteorobiologie Des Menschen - Olaf Kind Ohne Sprache - Objektorientierte Software In Der Kommerziellen Anwendung - Journalistenausbildung Eine Vernderte Medienwelt - Wertorientierung Und Zweckrationalitt - Latex Vademecum - Das Ja Zur Politik - Einhrung In Die Soziologie Der Behinderung - Geschlecht Und Gesundheit Im Jugendalter - Reproductive Biology And Plant Breeding - 5-phasen-methode Der Markenbewertung - Turbulent Shear Flows 9 - Die Lehre Vom Wirtschaftsbetrieb Allgemeine Betriebswirtschaftslehre - Kompaktkurs Physik - Zukunftssicherung Die Bauwirtschaft - Gefeuert Und Jetzt - Satellitenortung Und Navigation - Robotersysteme 2 - Baustoffchemie - Bacteria In Agrobiology Plant Probiotics - Die Entwickelung Der Automatischen Telegraphie - Geometrische Und Algebraische Methoden Der Physik Supermannigfaltigkeiten Und Virasoro-algebren - Die Gasdeme Des Menschen - Die Grund- Und Endprobleme Der Erkenntnis - Berlin Von Der Geteilten Zur Gespaltenen Stadt - Methoden Der Empirischen Gruppentherapieforschung - Abwehrfermente - Kreditsicherheiten - Im Schatten Demokratischer Legitimitt - Soziologielehre In Deutschland - A History Of Experimental Virology - Integrated Usage Mining - Brain Behaviour And Iron In The Infant Diet - Kulturkampf Oder Friede In Staat Und Kirche - Die Hochspannungs-gleichstrommaschine - Wissensspeicher Tribotechnik - Soziale Arbeit Und Soziales Kapital - Elektrothermie - Nichtlineare Dynamik Bifurkation Und Chaotische Systeme - Die Stationre Psychotherapie Und Ihr Rahmen - Complex Systems Design And Management - Die Reichsdienststrafordnung Rdsto - Psychological Treatment Of Mental Illness - Arteriosklerose - S+spatialstats - Computerlinguistik - Management Im Vernetzten Unternehmen - Die Alten Und Das Netz - Die Physikalisch-chemischen Grundlagen Der Biologie - Die Digitale Kluft - Die Chemie Der Bau- Und Betriebsstoffe Des Dampfkesselwesens - Das Krebsproblem - Die Kche Im Wohnerlebnis Der Deutschen - Pascal Wirtschaftswissenschaftler - Gabler Wirtschaftslexikon - Der Sektionskurs Kurze Anleitung Zur Pathologisch-anatomischen Untersuchung Menschlicher Leichen - Static And Dynamic Analyses Of Plates And Shells - Jakob Michael Reinhold Lenz - Eine Einladung In Die Mathematik - Kosss Cytology Of The Urinary Tract With Histopathologic Correlations - Wahlen Und Politikvermittlung Durch Massenmedien - Der Soziologische Blick - Das System Der Politik - The Effect Of Fluorine-containing Emissions On Conifers - Histologischer Atlas Von Zupfprparaten Unfixierter Menschlicher Organe Und Gewebe - Hyperbolic Equations And Waves - Die Gasbehandlung Bsartiger Geschwlste - Politische –konomie - Gabler Volkswirtschafts Lexikon - Wider Die Sozialistische Familiennorm - Arbeitsbuch Zur Produktionspolitik - Alterspsychotherapie Quo Vadis - Elektrotechnik Architekten Bauingenieure Und Gebudetechniker - Spermatology - Kraftmaschinen Und Arbeitsmaschinen - Parteien - Spuren Des Geistigen - Supervision Im Fokus - Ethical Social Index Numbers - Der „information Superhighway - Handbook Of Space Security - Der Assistenzarzt - Contributions To Functional Analysis - Systemwechsel 4 - Klinisches Jahrbuch - Strategisches Management Von Personalrisiken - Ion Tracks And Microtechnology - Armutsforschung Und Sozialberichterstattung In Den Neuen Bundeslndern - Die Elektrische Kraftbertragung - Gabler Lexikon Vertrieb Und Handel - Alte Menschen In Ihrer Umwelt - Leadership In Krisen - Artificial Heart 3 - Das Soziale Als Ritual - Coal-bearing Depositional Systems - Kinder Und Der Medienmarkt Der 90er Jahre - Physikalischen Und Chemischen Methoden Der Quantitativen Bestimmung Organischer Verbindungen - Nfstellige Tabellen Zu Den Elliptischen Funktionen Five Place Tables Of Elliptical Functions - Ditetische Kche Klinik Sanatorium Und Haus - Dokumentenakkreditivgeschft - Rechtsextremismus - Einhrung In Die Interaktionistische Ethnografie - Quantitative Methoden In Den Wirtschaftswissenschaften - Theoretical Geomorphology - Corporate Identity - Kulturpolitik Und Nationale Identitt - Mitteilungen Der Deutschen Materialprfungsanstalten - Einhrung In Die Sozialwissenschaftliche Datenanalyse - Die Geschichte Der Frauenbewegung In Deutschland - Arbeitsrecht 1 - Der Einfluy Der Rckgewinnbaren Yerlustwrme Des Hochdruckteils Auf Den Dampfverbrauch Der Dampf-turbinen - Elektrophysiologische Und Vegetative Phnomene Bei Stereotaktischen Hirnoperationen - Sozialpsychiatrie Und Kunsttherapie - Einhrung In Die Netzwerkanalyse Mit Spice - Developmental Neuropathology - Der Wald Und Die Gesetzgebung - Allgemeine Energiewirtschaftslehre - Free Radicals And The Liver - Einhrung In Die Spieltheorie - Familie Und Sozialisation In Der Ddr - Der Pdagoge Salzmann - Industrial Crystallization - Weltorganisationen - Reliability Evaluation Of Power Systems - Chemical Elements In The Environment - Investitionstheorie Und Investitionspolitik Privater Und Ffentlicher Unternehmen - –ffentliche Meinung Und Politik - Litigation-pr Alles Was Recht Ist - Handbuch Klebtechnik 20102011 - Menschenrechtserziehung In Der Schule - Hochwertiger Grauguy Und Die Physikalisch-metallurgischen Grundlagen Seiner Herstellung - Interfaces Und Datennetze - Wege Zur Hochschulreife In Baden-wrttemberg - Reformen Jetzt! - Eine Verfassung Die Europische Union - Das Englische Verwaltungsrecht Mit Einschluy Des Heeres Der Gerichte Und Der Kirche Geschichtsich Und Systematisch - Meilensteine Der Frauen- Und Geschlechterforschung - Journalisten Zwischen Den Fronten - Technische Mechanik Festigkeitslehre - Kulturelle Grundlagen Der Medialisierung In Sdkorea - Frankreich Und Das Vereinigte Deutschland - Snack Food Technology - Online-wahlen - Rundfunkkonomie - Das Novellierte Gesetz œber Das Gerichtliche Verfahren Ausser Streitsachen Verlassenschaftsabhandlung Vormundschaft · Freiwillige Schtzung Und Feilbietung - Fit Im Bro - Leitfaden Arithmetik - Lees Ophthalmic Histopathology - Betriebswirtschaftliche Hrungslehre Grundlagen Strategien Modelle - Statistik Leicht Gemacht - Boom-branchen 50plus - Altersbilder In Der Professionellen Altenpflege - Ethik Als Pdagogisches Projekt - Massivbau - Die Ausrstung Der Textilen Waren - Kommunikationsanschlsse - Frankreich-jahrbuch 2001 - Rational Choice Und Theoriegeleitete Evaluationsforschung - Aktuelle Probleme Der Nephrologie - Was Lsst Ehen Heute Noch Gelingen - Baufachrechnen - Die Fabrikation Der Soda Nach Dem Ammoniakverfahren - Kloster Und Abt - Der Reiz Des Trivialen - Benchmarking - Sleep Related Disorders And Internal Diseases - Windows Phone Recipes - Angewandte Tensorrechnung - Musik Als Utopie - Die Montage Im Flexiblen Produktionsbetrieb - C Unter Unix - Arbeit In Interkulturellen Teams - Journalistische Ethik - Das Prometheus-projekt - Zwischen Deutscher Und Jdischer Identitt - Limb Salvage - Jugendliche + Erwachsene 85 Generationen Im Vergleich - Geometric Structure Of High-dimensional Data And Dimensionality Reduction - Doppelte Buchhrung - Early Organic Evolution - Cultural Economics - Weltordnung Durch Us-leadership - Wahlkampf In Baden-wrttemberg - Thin-layer Chromatography - Migration Zu Windows 2000 - Mikrowellenmesstechnik - Der Versicherungsverkufer - Lehrbuch Der Physiologie Studierende Der Zahnheilkunde - Hypnotismus Und Medizin - Die Entwicklung Der Kausalitt Im Kulturvergleich - Die Meinungsmacher In Der Mediengesellschaft - Kartellrecht In Der Unternehmenspraxis - Urbane Soziale Brennpunkte Exklusion Und Soziale Hilfe - Contested Public Spheres - Offensive Marktpositionierung - Handbuch Der Polizeien Deutschlands - New Developments For Limb Salvage In Musculoskeletal Tumors - Die Zukunft In Amerika - Die Organismusidee In Mllers Dauerwaldgedanken - Handbuch Stadtsoziologie - Power In Procurement - Die Widerstandsfhigkeit Von Dampfkesselwandungen - Aleksandr Porfirevich Borodin - Mediastinale Sonographie - Der Heutige Stand Der Chemotherapeutischen Carcinomforschung - Ideologie Nach Ihrem ‚ende‘ - International Compendium Of Numerical Data Projects - Gesellschaft Technik Politik - Nicolaus Steno - Max Weber Und Die Entzauberung Der Medienwelt - Recombinant Human Erythropoietin Rhepo In Clinical Oncology - Vom Zukunfts- Zum Auslaufmodell - Transparenz In Arbeitsorganisationen - Das Sldnerwesen - Spielen Frauen Ein Anderes Spiel - Sicherheit In Netzgesttzten Informationssystemen - Trafficking In Women In The European Union - Die Cdu Auf Landesebene - Dictionary Of Abbreviations In Medical Sciences - Spanende Werkzeugmaschinen - Alltag Im Kz - Zukunft Von Stadt Und Region - Die Wirtschaftliche Arbeitsweise In Den Werksttten Der Maschinenfabriken - Die Permeabilittspathologie - 55plus Marketing - Theorie Der Public Relations - „lieber Herr Fuchs Lieber Herr Schmatz! - Altern Bewegt - Virtuelle Wirtschaft - Migration Familie Und Gesellschaft - Handbuch Des Bankmarketing - Advances In Oceanography - Lernendes Unternehmen - Benjamin Constant Und Der Liberale Verfassungsstaat - Soziale Stadtentwicklung - Exklusionsindividualitt - Hilfsbuch Mineralltechniker Stoffkonstanten Und Berechnungsunterlagen Apparatebauer Ingenieure Betriebsleiter Und Chemiker Der Minerallindustrie - Bernhard Heines Versuche Ber Knochenregeneration - Die Literarische Moderne In Europa - Die Dynamische Produktion - Bedrfnis Und Befriedigung - Entwicklung Und Bedeutung Der Betriebswirtschaftlichen Theorie - Visions And Strategies In European Integration - Entstehung Und Entwicklung Des Rechtsextremismus In Der Bundesrepublik - Elektromagnetische Strahlungsfelder - Berechnungen Konstruktionsgrundlagen Und Bauelemente Spanender Werkzeugmaschinen - Die Wichtigsten Krankheiten Des Kaninchens - Recursive Block Coding For Image Data Compression - Analyse Der Harze Balsame Und Gummiharze Nebst Ihrer Chemie Und Pharmakognosie - Bergbaumechanik - Frankreich Europa Weltpolitik - Soziologie Im Wandel - Metastatic Bone Disease - Klinik Der Missbildungen Und Kongenitalen Erkrankungen Des Ftus - Pdagogik Und Ethik - Handbuch Organisationstypen - Oxygen Sensing In Tissues - Stichwort Wahlen - Computational Fluid Dynamics Based On The Unified Coordinates - 9 Kongrey Der Deutschsprachigen Gesellschaft Intraokularlinsen Implantation - Habsburg Und Hohenzollern - Analyse Der Azofarbstoffe - Serien-welten - Sustainability In Tourism - Ganztgige Bildung Und Betreuung Im Primarschulalter - Leben Und Arbeit - Quantitative Methoden Der Organisationsforschung - Philosophie Und Hrung - Keine Probleme Mit Inversen Problemen - Dein Mutmacher Bist Du Selbst! - Vernderungsmanagement - Studienbuch Politikwissenschaft - Schlkes Formeln - Autonome Innervation Des Herzens Myokardiale Hypoxie - Sachsen-anhalt - Rume Der Emanzipation - Expertensystemshell Deduc Wissensdynamik Mit Deduc - Zeit Und Arbeit - Organoselenium Chemistry I - Programmieren Mit C - Prognosefhiger Erfolg Nach Iasifrs - Potassium Argon Dating - Die Geschichte Einer Jugend - Nuclear Simulation - Frontiers In Social Dilemmas Research - Blattern Und Schutzpockenimpfung - Autochthone Modernitt - Praxiswissen Anzeigenverkauf - The Embryology Of The Human Locomotor System - Harderian Glands - Allergic Contact Dermatitis - Governing The Uncertain - Moderne Identitt Und Gesellschaft - Recent Developments In Mathematical Physics - Wirtschaftliche Rationalitt - Kohlenwasserstoffle Und Fette Sowie Die Ihnen Chemisch Und Technisch Nahestehenden Stoffe - Tatort Familie - Pseudocholinesterasen - Schulpolitik Und Schulsystem In Der Ddr - Jugend Und Mode - Praxisfeld Hilfe Zur Erziehung - Abriss Der Dauermagnetkunde - Digital Control Systems - Experimental Analysis Of Insect Behaviour - Wieviel Management Braucht Der Mensch - Burnout Aus Ressourcenorientierter Sicht Im Geschlechtervergleich - Contemporary Research Methods In Neuroanatomy - Jugend Politik Und Politische Bildung - Soziale Identitten Jugendlicher - Diagnostik Der Kinderkrankheiten Mit Besonderer Bercksichtigung Des Suglings - Interaktionsformen - Hochspannungsforschung Und Hochspannungspraxis - Cross-border Venture Capital Investments - Diskurs Und Entscheidung - Mri Of The Head And Neck - Norm Herrschaft Und Vertrauen - Amerikas Eindringen In Das Europische Wirtschaftsgebiet - Kohlenwasserstoffle Und Fette - Das Weltgebude Im Lichte Der Neueren Forschung - Pains And Gains Of International Mobility In Teacher Education - Der Kontaktumformer - Der Politikzyklus Zwischen Bonn Und Brssel - A New Institutional Economics Perspective On Industry Self-regulation - Die Bundesrepublik In Den Achtziger Jahren - Jahrbuch Medienpdagogik 9 - Hilfsbuch Die Elektrotechnik - High-risk Breast Cancer - Die Gonorrhoe Des Weibes - Schlerinnen Und Schler Am Denkmal Die Ermordeten Juden Europas - Unternehmensdynamik - Inszenierungen Zur Gentechnik - Die Natrliche Und Knstliche Alterung Des Gehrteten Stahles - Biomechanik - Einhrung In Die Komplexe Behandlung Von Wechselstromaufgaben - Der Augenhintergrund Bei Allgemeinerkrankungen - Mixed Methods - Poetik Des Abgrunds Und Kunst Des Widerstands - Herzerkrankungen Und Interventions-mglichkeiten - Gemeinntzigkeitsrecht Soziale Einrichtungen - Skandal Massenarbeitslosigkeit - Der Fall Schwerte Im Kontext - Histopathology Of The Endometrium - Die Edelstahlerzeugung - Mathematikknobeleien - Die Cerebrospinalflssigkeit - Der Gegenstand Der Psychologie - Vorrichtungsbau - Das Elektrische Kabel - Journalismus Als Kultureller Prozess - Statistische Datenanalyse Mit Spsspc+ - Lehmbau - Tradition Und Transformation - Pflegesicherung In Europa - Gemeinschaftsformen In Der Modernen Stadt - Der Operierte Kranke - Instrumental Methods And Scoring In Extrapyramidal Disorders - Kindheit Soziologisch - Grundkurs Politikwissenschaft Einhrung Ins Wissenschaftliche Arbeiten - Biology Of Desert Invertebrates - „als Der Krieg Kam Hatte Ich Mit Hitler Nichts Mehr Zu Tun - Der Kondensator In Der Starkstromtechnik - Aquaculture Management - Bildlexikon Der Dermatologie - Handbook On Hyperbaric Medicine - Die Geburt Der Vernunft - Lnder-parlamentarismus In Deutschland - Developments In Food Microbiology4 - Farbempfindung Farbbeschreibung Und Farbmessung - Future Of Civil Society - Sap-gesttztes Rechnungswesen - Geschftsmodelle Quadruple Play - 4 Kongrey Der Deutschen Gesellschaft Intraokularlinsen Implantation - Lehrbuch Der Geometrischen Optik - Urbanitt - Facebook Und Co - Journalistinnen In Europa - Schub Und Torsion In Geraden Stben - Atrial Fibrillation - Investments 2010 - Orphan Lung Diseases - Heraus Forderungen Antworten - Handbuch Militrische Berufsethik - Erfolgreiche Datenbankanwendung Mit Sql3 - Rasse Und Ethnizitt - Die Nachbehandlung Nach Operationen - Ankunft Im Erwachsenenleben - Wandel Von Der Telekommunikation Zu Unified Communications - Bauphysikalische Aufgabensammlung Mit Lsungen - Patientenwelten - Statical And Geomechanical Models - Perestrojka Pass© - Arteriosklerose Und Fibrininkorporation - Die Licht-therapie - Die Konstruktiven Grundlagen Des Wrme- Und Klteschutzes Im Wohn- Und Industriebau - Jahrbuch Handlungs- Und Entscheidungstheorie - Hair And Hair Diseases - Parteimitglieder Im Wandel - Termersetzungssysteme - Klinikalltag Und Arbeitszufriedenheit - Gabler Lexikon Corporate Finance - Staat Markt Und Rente In Der Internationalen Politik - Lebensjahre Im Schatten Der Deutschen Grenze - Das Licht Im Grundsystem Des Kohlenhydratstoffwechsels - Handbuch Der Feuerungstechnik Und Des Dampfkesselbetriebes - Concurrent Simultaneous Engineering Systems - Korrelationssignale - Atlas Of Interstitial Cells Of Cajal In The Gastrointestinal Tract - Erstes Jahrbuch Des Kriegsspitals Der Geldinstitute In Budapest - Unerwartete Todesflle In Klinik Und Praxis - Jahrbuch Soziologiegeschichte 1990 - The Measurement Of Turbulent Fluctuations - Mediensozialisation Von Heranwachsenden - Tick Vector Biology - Sozialpolitische Strategien Gegen Armut - Der Geldstag Oder Die Wirthschaft Nach Der Neuen Mode - Sonographie Der Kopf-hals-region - Computer Im Deutschen Bundestag - Bildungsdienstleistung Elearning - Klausurtraining Statik - Grundriss Der Allgemeinen Chirurgie - A Dictionary Of Real Numbers - Frakturen Und Luxationen - Urosonographische Differentialdiagnose - Differenzengeometrie - Cardiac Pathology - Grundlagen Der Hrung - Lob Des Nfecks - Nuclear Endocrinology - Optimierung Technischer Produkte Und Prozesse - Der Kesselbaustoff - Proactive Intelligence - Rollenmodelle Der Hrung - Advances In Nuclear Physics - Elektrotechnisches Praktikum - Mdchenfreundschaften In Der Adoleszenz - Soziologie Der Kunst - Die Altauto-verordnung - Spirituality Education And Society - Einhrung In Die Koordinationschemie - Technik Und Demokratie - Blutkonservierung Und Transfusion Von Konserviertem Blut - Analog Integrated Circuits For Communication - Assisted Circulation 3 - Grundlagen Der Konstruktion - Algebraische Strukturen - Multikulturelle Demokratien Im Vergleich - Computational Organometallic Chemistry - Higher Education And Human Capital Rethinking The Doctorate In America - Familienbilder - Distressed Mergers And Acquisitions - Advertisers At Work - Prfungstrainer Physik - Sicherheit Und Integration In Europa - Implementation Politischer Programme Ii - Cell And Tissue Culture Models In Dermatological Research - Taking Your Ipod Touch To The Max Ios 5 Edition - Unternehmensgrndung Und Dezentralitt - Risk Management And Hazardous Waste - Nutzungswandel Und Stdtebauliche Steuerung - Step Standard For The Exchange Of Product Model Data - Mathematische Grundlagen Der Hheren Geodsie Und Kartographie - Die Turbinen Wasserkraftbetrieb - Towards One-pass Synthesis - Politik Als Lernprozess - Aushrung Potentiometrischer Analysen Nebst Vollstndigen Analysenvorschriften Technische Produkte - Cure Of Thermosetting Resins - The Internet For Surgeons - Der Kiefernspanner Bupalus Piniarius L - Gewalt Als Soziales Problem In Schulen - Kritische Differenzen Geteilte Perspektiven - Vermgensverwaltung Mit Fondspicking - Mental Health Outcome Measures - Wie Aus Ideen Bilder Werden - Forstliches Rechnen - Arbeiten Der Lehrkanzel Tierzucht An Der Hochschule Bodenkultur In Wien - Der Entschlsselte Wachstumscode - Introduction To Formal Grammars - Hochqualifiziert Und Arbeitslos - Regulierung Und Unternehmenspolitik - Medienalltag Und Handeln - Die Technik Und Der Krieg - Brckenbausysteme Mittelgroye Spannweiten - Principles Of Genetic Toxicology - Grundzge Der Zerspanungslehre Theorie Und Praxis Der Zerspanung Bau Und Betrieb Von Werkzeugmaschinen - Weiterbildung Von Frauen In Den Neuen Bundeslndern - Konflikte Konstruktiv Bearbeiten Lernen - Entwicklung Und Sozialisation Von Jugendlichen Vor Und Nach Der Vereinigung Deutschlands - Bericht Ber Die Xxii Tagung Kriegstagung - Enzymopathologie - Wert- Und Bedrfnisorientierte Segmentierung Von Konsumgtermrkten - Die Prfung Und Die Eigenschaften Der Kalksandsteine - Die Frberei Und Bleicherei Der Gespinnstfasern - Innovationskompetenz In Unternehmen -